{
    "uniprot_canonical_ac": "Q12483-1",
    "uniprot_ac": "Q12483",
    "uniprot_id": "SNF8_YEAST",
    "mass": {
        "chemical_mass": 26954.0,
        "monoisotopic_mass": 26954.0
    },
    "refseq": {
        "ac": "NP_015323",
        "name": "ESCRT-II subunit protein SNF8",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015323"
    },
    "gene_names": [
        {
            "name": "SNF8",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q12483",
            "id": "Q12483"
        },
        {
            "name": "SNF8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015323",
            "id": "NP_015323"
        },
        {
            "name": "VPL14; VPS22",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015323",
            "id": "NP_015323"
        },
        {
            "name": "VPS22",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q12483",
            "id": "Q12483"
        }
    ],
    "protein_names": [
        {
            "name": "Vacuolar-sorting protein SNF8",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q12483"
        },
        {
            "name": "ESCRT-II complex subunit VPS22",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q12483"
        },
        {
            "name": "ESCRT-II subunit protein SNF8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015323",
            "id": "NP_015323"
        },
        {
            "name": "Vacuolar protein-sorting-associated protein 22",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q12483"
        }
    ],
    "function": [
        {
            "annotation": "Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483#function"
                },
                {
                    "database": "PubMed",
                    "id": "12194858",
                    "url": "https://glygen.org/publication/PubMed/12194858"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:162",
            "recommended_name": {
                "id": "DOID:162",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:162",
                "name": "cancer",
                "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis."
            },
            "synonyms": [
                {
                    "id": "DOID:162",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:162",
                    "name": "malignant neoplasm",
                    "description": ""
                },
                {
                    "id": "DOID:162",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:162",
                    "name": "malignant tumor",
                    "description": ""
                },
                {
                    "id": "DOID:162",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:162",
                    "name": "primary cancer",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "162",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:162"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "SNF8",
            "url": "https://www.uniprot.org/uniprot/Q12483",
            "locus": {
                "chromosome": "XVI",
                "start_pos": 553627,
                "end_pos": 554328,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YPL002C",
                        "url": "https://www.ensembl.org/id/YPL002C"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "856105",
            "url": "https://www.ncbi.nlm.nih.gov/gene/856105",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q12483",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q12483*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR016689",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016689",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036388",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036390",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR040608",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR040608",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YPL002C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL002C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "SFRAQFA",
            "url": "https://omabrowser.org/oma/group/SFRAQFA/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "276217at2759",
            "url": "http://www.orthodb.org/?query=276217at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12806",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12806",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12806:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12806:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1U5T",
            "url": "https://www.rcsb.org/structure/1U5T",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1W7P",
            "url": "https://www.rcsb.org/structure/1W7P",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF04157",
            "url": "http://pfam.xfam.org/family/PF04157",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q12483",
            "url": "http://purl.obolibrary.org/obo/PR_Q12483",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_015323",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015323",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005923",
            "url": "https://www.yeastgenome.org/locus/S000005923",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q12483",
            "url": "https://www.uniprot.org/uniprot/Q12483",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q12483-1",
            "url": "https://www.uniprot.org/uniprot/Q12483-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL",
        "length": 233,
        "header": "sp|Q12483-1|SNF8_YEAST Isoform 1 of Vacuolar-sorting protein SNF8  OS=Saccharomyces cerevisiae S288C OX=559292 GN=SNF8 PE=1 SV=1 CANONICAL=Q12483-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q12483-1",
            "url": "",
            "sequence": {
                "sequence": "MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL",
                "length": 233,
                "header": "sp|Q12483-1|SNF8_YEAST Isoform 1 of Vacuolar-sorting protein SNF8  OS=Saccharomyces cerevisiae S288C OX=559292 GN=SNF8 PE=1 SV=1 CANONICAL=Q12483-1"
            },
            "locus": {
                "chromosome": "XVI",
                "start_pos": 554328,
                "end_pos": 553630,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YPL002C_mRNA",
                        "url": "https://www.ensembl.org/id/YPL002C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YPL002C",
                        "url": "https://www.ensembl.org/id/YPL002C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Endosome-associated complex, ESCRT-II, recruits transport machinery for protein sorting at the multivesicular body.",
            "journal": "Dev. Cell",
            "date": "2002",
            "authors": "Wendland B., Babst M., Emr S.D., Snyder W.B., Katzmann D.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12194858",
                    "url": "https://glygen.org/publication/PubMed/12194858"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Structure of the ESCRT-II endosomal trafficking complex.",
            "journal": "Nature",
            "date": "2004",
            "authors": "Kim J., Sun J., Hurley J.H., Emr S.D., Hierro A., Prag G., Rusnak A.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15329733",
                    "url": "https://glygen.org/publication/PubMed/15329733"
                }
            ]
        },
        {
            "title": "ESCRT-II, an endosome-associated complex required for protein sorting: crystal structure and interactions with ESCRT-III and membranes.",
            "journal": "Dev. Cell",
            "date": "2004",
            "authors": "Perisic O., Williams R.L., Gonzalez B., Teo H.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15469844",
                    "url": "https://glygen.org/publication/PubMed/15469844"
                }
            ]
        },
        {
            "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.",
            "journal": "Genome Res.",
            "date": "2007",
            "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17322287",
                    "url": "https://glygen.org/publication/PubMed/17322287"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Molecular analysis of the SNF8 gene of Saccharomyces cerevisiae.",
            "journal": "Yeast",
            "date": "1995",
            "authors": "Carlson M., Tu J., Yeghiayan P., Vallier L.G.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7785322",
                    "url": "https://glygen.org/publication/PubMed/7785322"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12483",
                    "url": "https://www.uniprot.org/uniprot/Q12483"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169875",
                    "url": "https://glygen.org/publication/PubMed/9169875"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YPL002C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL002C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q5RK19-1",
            "protein_name": "Vacuolar-sorting protein SNF8",
            "gene_name": "Snf8",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEISAEEAKEVFP",
                "length": 258
            },
            "evidence": [
                {
                    "id": "Q12483",
                    "url": "https://omabrowser.org/oma/group/Q12483/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q96H20-1",
            "protein_name": "Vacuolar-sorting protein SNF8",
            "gene_name": "SNF8",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP",
                "length": 258
            },
            "evidence": [
                {
                    "id": "Q12483",
                    "url": "https://omabrowser.org/oma/group/Q12483/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9CZ28-1",
            "protein_name": "Vacuolar-sorting protein SNF8",
            "gene_name": "Snf8",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEISAEEAKEAFP",
                "length": 258
            },
            "evidence": [
                {
                    "id": "Q12483",
                    "url": "https://omabrowser.org/oma/group/Q12483/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "ESCRT II complex",
                        "id": "GO:0000814",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000814",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 5,
                "go_terms": [
                    {
                        "name": "protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway",
                        "id": "GO:0043328",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043328",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "carbon catabolite repression of transcription from RNA polymerase II promoter by glucose",
                        "id": "GO:0000433",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000433",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein targeting to vacuole",
                        "id": "GO:0006623",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006623",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway",
                        "id": "GO:0043162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ATP export",
                        "id": "GO:1904669",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904669",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "lipid binding",
                        "id": "GO:0008289",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12483",
                                "url": "https://www.uniprot.org/uniprot/Q12483"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 21,
            "end_pos": 23,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 8
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}