{
    "uniprot_canonical_ac": "Q12272-1",
    "uniprot_ac": "Q12272",
    "uniprot_id": "TPT1_YEAST",
    "mass": {
        "chemical_mass": 26196.0,
        "monoisotopic_mass": 26196.0
    },
    "refseq": {
        "ac": "NP_014539",
        "name": "tRNA 2'-phosphotransferase",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014539"
    },
    "gene_names": [
        {
            "name": "TPT1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q12272",
            "id": "Q12272"
        },
        {
            "name": "HRE230",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q12272",
            "id": "Q12272"
        },
        {
            "name": "TPT1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014539",
            "id": "NP_014539"
        }
    ],
    "protein_names": [
        {
            "name": "tRNA 2'-phosphotransferase",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q12272"
        },
        {
            "name": "2.7.1.160",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q12272"
        },
        {
            "name": "tRNA 2'-phosphotransferase",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014539",
            "id": "NP_014539"
        }
    ],
    "function": [
        {
            "annotation": "Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272#function"
                },
                {
                    "database": "PubMed",
                    "id": "9148937",
                    "url": "https://glygen.org/publication/PubMed/9148937"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "TPT1",
            "url": "https://www.uniprot.org/uniprot/Q12272",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "2.7.1.160",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.160&UniProtAcc=Q12272",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "854051",
            "url": "https://www.ncbi.nlm.nih.gov/gene/854051",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q12272",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q12272*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR002745",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002745",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR042080",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR042080",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR042081",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR042081",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YOL102C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL102C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "YLYHGTV",
            "url": "https://omabrowser.org/oma/group/YLYHGTV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "443016at2759",
            "url": "http://www.orthodb.org/?query=443016at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12684",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12684",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12684:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12684:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01885",
            "url": "http://pfam.xfam.org/family/PF01885",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q12272",
            "url": "http://purl.obolibrary.org/obo/PR_Q12272",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014539",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014539",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005462",
            "url": "https://www.yeastgenome.org/locus/S000005462",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q12272",
            "url": "https://www.uniprot.org/uniprot/Q12272",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q12272-1",
            "url": "https://www.uniprot.org/uniprot/Q12272-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDIHRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTNLQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKMFRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI",
        "length": 230,
        "header": "sp|Q12272-1|TPT1_YEAST Isoform 1 of tRNA 2'-phosphotransferase  OS=Saccharomyces cerevisiae S288C OX=559292 GN=TPT1 PE=1 SV=1 CANONICAL=Q12272-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q12272-1",
            "url": "",
            "sequence": {
                "sequence": "MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDIHRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTNLQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKMFRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI",
                "length": 230,
                "header": "sp|Q12272-1|TPT1_YEAST Isoform 1 of tRNA 2'-phosphotransferase  OS=Saccharomyces cerevisiae S288C OX=559292 GN=TPT1 PE=1 SV=1 CANONICAL=Q12272-1"
            },
            "locus": {
                "chromosome": "XV",
                "start_pos": 126689,
                "end_pos": 126000,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YOL102C_mRNA",
                        "url": "https://www.ensembl.org/id/YOL102C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YOL102C",
                        "url": "https://www.ensembl.org/id/YOL102C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 19,
            "end_pos": 19,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q12272",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12272"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ],
            "site_lbl": "Ser19"
        }
    ],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q12272",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Ty1-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element.",
            "journal": "Yeast",
            "date": "1995",
            "authors": "Durand P., Portetelle D., Vandenbol M., Hilger F.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7502582",
                    "url": "https://glygen.org/publication/PubMed/7502582"
                }
            ]
        },
        {
            "title": "A 2'-phosphotransferase implicated in tRNA splicing is essential in Saccharomyces cerevisiae.",
            "journal": "J. Biol. Chem.",
            "date": "1997",
            "authors": "Stanford D.R., Phizicky E.M., Consaul S.A., Culver G.M., McCraith S.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9148937",
                    "url": "https://glygen.org/publication/PubMed/9148937"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169874",
                    "url": "https://glygen.org/publication/PubMed/9169874"
                }
            ]
        },
        {
            "title": "Transient ADP-ribosylation of a 2'-phosphate implicated in its removal from ligated tRNA during splicing in yeast.",
            "journal": "J. Biol. Chem.",
            "date": "1999",
            "authors": "Phizicky E.M., Spinelli S.L., Kierzek R., Turner D.H.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q12272",
                    "url": "https://www.uniprot.org/uniprot/Q12272"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9915792",
                    "url": "https://glygen.org/publication/PubMed/9915792"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YOL102C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL102C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q86TN4-1",
            "protein_name": "tRNA 2'-phosphotransferase 1",
            "gene_name": "TRPT1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MNFSGGGRQEAAGSRGRRAPRPREQDRDVQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ",
                "length": 253
            },
            "evidence": [
                {
                    "id": "Q12272",
                    "url": "https://omabrowser.org/oma/group/Q12272/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q8K3A2-1",
            "protein_name": "tRNA 2'-phosphotransferase 1",
            "gene_name": "Trpt1",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MNAPGGRRKEGRRTHRPREQDRNVQLSKALSYALRHGALKLGLPMRADGFVPLQALLQLPQFHSFSIEDVQLVVNTNEKQRFTLQPGEPSTGLLIRANQGHSLQVPELELTPLETPQALPLTLVHGTFWKHWPSILLKGLSRQGRTHIHLASGLPGDPGVISGIRPNCEVAVFIDGPLALTDGIPFFCSANGVILTPGNAEGFLLPKYFKEALQLRPTRKPLSLAGDKETETQSGPKLSSRGGRRKIQQ",
                "length": 249
            },
            "evidence": [
                {
                    "id": "Q12272",
                    "url": "https://omabrowser.org/oma/group/Q12272/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12272",
                                "url": "https://www.uniprot.org/uniprot/Q12272"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12272",
                                "url": "https://www.uniprot.org/uniprot/Q12272"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "tRNA 2'-phosphotransferase activity",
                        "id": "GO:0000215",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000215",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12272",
                                "url": "https://www.uniprot.org/uniprot/Q12272"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "tRNA splicing, via endonucleolytic cleavage and ligation",
                        "id": "GO:0006388",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006388",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q12272",
                                "url": "https://www.uniprot.org/uniprot/Q12272"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "23324",
            "name": "",
            "equation": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "D3ZBT6-1",
                "Q86TN4-1",
                "Q8K3A2-1",
                "Q12272-1",
                "Q54L34-1",
                "Q86BH3-1"
            ],
            "evidence": [
                {
                    "id": "23324",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/23324"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [
        {
            "uniprot_ac": "D3ZBT6",
            "gene_name": "Trpt1",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "D3ZBT6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBT6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZBT6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBT6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q12272",
            "gene_name": "TPT1",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q12272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12272"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q12272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12272"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54L34",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q54L34",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54L34"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54L34",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54L34"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q86BH3",
            "gene_name": "Tpt",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q86BH3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q86BH3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q86BH3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q86BH3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q86TN4",
            "gene_name": "TRPT1",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q86TN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q86TN4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q86TN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q86TN4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8K3A2",
            "gene_name": "Trpt1",
            "activity": [
                {
                    "ec_number": "2.7.1.160",
                    "activity": "2'-phospho-[ligated tRNA] + NAD(+) = ADP-alpha-D-ribose 1'',2''-cyclic phosphate + mature tRNA + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q8K3A2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8K3A2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.160",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8K3A2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8K3A2"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}