{ "uniprot_canonical_ac": "Q12167-1", "uniprot_ac": "Q12167", "uniprot_id": "RRG1_YEAST", "mass": { "chemical_mass": 42829.0, "monoisotopic_mass": 42829.0 }, "refseq": { "ac": "NP_010350", "name": "Rrg1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010350" }, "gene_names": [ { "name": "RRG1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q12167", "id": "Q12167" }, { "name": "D4258", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q12167", "id": "Q12167" }, { "name": "MTA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010350", "id": "NP_010350" }, { "name": "RRG1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010350", "id": "NP_010350" } ], "protein_names": [ { "name": "Required for respiratory growth protein 1, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q12167" }, { "name": "Rrg1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010350", "id": "NP_010350" } ], "function": [ { "annotation": "Essential for respiratory growth and required for mitochondrial protein synthesis. Required for vacuolar acidification.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167#function" }, { "database": "PubMed", "id": "19751518", "url": "https://glygen.org/publication/PubMed/19751518" }, { "database": "PubMed", "id": "16168084", "url": "https://glygen.org/publication/PubMed/16168084" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RRG1", "url": "https://www.uniprot.org/uniprot/Q12167", "locus": {} } ], "crossref": [ { "id": "851637", "url": "https://www.ncbi.nlm.nih.gov/gene/851637", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q12167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q12167*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YDR065W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR065W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WYRYTLR", "url": "https://omabrowser.org/oma/group/WYRYTLR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2021797at2759", "url": "http://www.orthodb.org/?query=2021797at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_Q12167", "url": "http://purl.obolibrary.org/obo/PR_Q12167", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010350", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010350", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002472", "url": "https://www.yeastgenome.org/locus/S000002472", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q12167-1", "url": "https://www.uniprot.org/uniprot/Q12167-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQNFGKIPSHKSYVLSLYRTVLRNIPKCCHSYAFQYEIKKTLSIQLFKHKHDKSSWSVYTLLNEFSLLNNCLLEGKLQEIKNLMKPLKKMKKQLKTTKILNSLTSLGDVKTNDPEEVRRFHVLSAYIKRKQDLGLLPAYIPKTYQHKLLLPLALNEHACLKLFHIQQKLKNGPPSAGLSYTKEGRNQIWFVRSPINKGRQQSKKLGILIRKERKDSQKNIDNLNFCEINAAWALHEAIWEEYLESKKIIKVNLPKYLEYAANIPKSTKCNPSSQYQKVKEWVDPVREIMFELHSKSFQRVEYFNKYKEKLLKNGGQLAYFDKKSKEMYAKRLTLFRKMSKETLPYVTLFIEGRDLPSVLAKYGF", "length": 365, "header": "sp|Q12167-1|RRG1_YEAST Isoform 1 of Required for respiratory growth protein 1, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=RRG1 PE=1 SV=1 CANONICAL=Q12167-1" }, "isoforms": [ { "isoform_ac": "Q12167-1", "url": "", "sequence": { "sequence": "MAQNFGKIPSHKSYVLSLYRTVLRNIPKCCHSYAFQYEIKKTLSIQLFKHKHDKSSWSVYTLLNEFSLLNNCLLEGKLQEIKNLMKPLKKMKKQLKTTKILNSLTSLGDVKTNDPEEVRRFHVLSAYIKRKQDLGLLPAYIPKTYQHKLLLPLALNEHACLKLFHIQQKLKNGPPSAGLSYTKEGRNQIWFVRSPINKGRQQSKKLGILIRKERKDSQKNIDNLNFCEINAAWALHEAIWEEYLESKKIIKVNLPKYLEYAANIPKSTKCNPSSQYQKVKEWVDPVREIMFELHSKSFQRVEYFNKYKEKLLKNGGQLAYFDKKSKEMYAKRLTLFRKMSKETLPYVTLFIEGRDLPSVLAKYGF", "length": 365, "header": "sp|Q12167-1|RRG1_YEAST Isoform 1 of Required for respiratory growth protein 1, mitochondrial OS=Saccharomyces cerevisiae S288C OX=559292 GN=RRG1 PE=1 SV=1 CANONICAL=Q12167-1" }, "locus": { "chromosome": "IV", "start_pos": 581781, "end_pos": 580687, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR065W_mRNA", "url": "https://www.ensembl.org/id/YDR065W_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR065W", "url": "https://www.ensembl.org/id/YDR065W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Characterization of the yeast ionome: a genome-wide analysis of nutrient mineral and trace element homeostasis in Saccharomyces cerevisiae.", "journal": "Genome Biol.", "date": "2005", "authors": "Clark S., Eide D.J., Gribskov M., Gehl M., Guerinot M.L., Harper J.F., Nair T.M.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "16168084", "url": "https://glygen.org/publication/PubMed/16168084" } ] }, { "title": "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics.", "journal": "J. Proteome Res.", "date": "2006", "authors": "Sickmann A., Zahedi R.P., Meisinger C., Reinders J., Pfanner N.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "16823961", "url": "https://glygen.org/publication/PubMed/16823961" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Genome-wide deletion mutant analysis reveals genes required for respiratory growth, mitochondrial genome maintenance and mitochondrial protein synthesis in Saccharomyces cerevisiae.", "journal": "Genome Biol.", "date": "2009", "authors": "Westermann B., Merz S.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "19751518", "url": "https://glygen.org/publication/PubMed/19751518" } ] }, { "title": "Global analysis of the glycoproteome in Saccharomyces cerevisiae reveals new roles for protein glycosylation in eukaryotes.", "journal": "Mol. Syst. Biol.", "date": "2009", "authors": "Kung Li A, Tao Sheng-Ce, Qian Jiang, Smith Michael G, Snyder Michael, Zhu Heng", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "19756047", "url": "https://glygen.org/publication/PubMed/19756047" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Nucleotide sequence analysis of a 32,500 bp region of the right arm of Saccharomyces cerevisiae chromosome IV.", "journal": "Yeast", "date": "1996", "authors": "Bloecker H., Brandt P., Otto B., Ramlow S.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "8789263", "url": "https://glygen.org/publication/PubMed/8789263" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR065W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR065W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "pmid": "" }, { "name": "matrix side of mitochondrial inner membrane", "id": "GO:0099617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099617", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "mitochondrial genome maintenance", "id": "GO:0000002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000002", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "pmid": "" }, { "name": "vacuolar acidification", "id": "GO:0007035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007035", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "pmid": "" }, { "name": "mitochondrial tRNA 5'-end processing", "id": "GO:0097745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097745", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "N-glycosylated. Glycosylation is important for correct localization of the protein.", "evidence": [ { "database": "UniProtKB", "id": "Q12167", "url": "https://www.uniprot.org/uniprot/Q12167" }, { "database": "PubMed", "id": "19756047", "url": "https://glygen.org/publication/PubMed/19756047" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }