{ "uniprot_canonical_ac": "Q09TK7-1", "uniprot_ac": "Q09TK7", "uniprot_id": "ISK11_MOUSE", "mass": { "chemical_mass": 10090.0, "monoisotopic_mass": 10090.0 }, "refseq": { "ac": "NP_001041682", "name": "serine protease inhibitor Kazal-type 11 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682" }, "gene_names": [ { "name": "Spink11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q09TK7", "id": "Q09TK7" }, { "name": "9230112K01Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682", "id": "NP_001041682" }, { "name": "Spink11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682", "id": "NP_001041682" } ], "protein_names": [ { "name": "Serine protease inhibitor Kazal-type 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q09TK7" }, { "name": "serine protease inhibitor Kazal-type 11 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682", "id": "NP_001041682" }, { "name": "serine protease inhibitor Kazal-type 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682", "id": "NP_001041682" } ], "function": [ { "annotation": "Probable serine protease inhibitor.", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Spink11", "url": "https://www.uniprot.org/uniprot/Q09TK7", "locus": { "chromosome": "18", "start_pos": 44323112, "end_pos": 44329244, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000073573", "url": "https://www.ensembl.org/id/ENSMUSG00000073573" } ] } } ], "crossref": [ { "id": "ENSMUSG00000073573", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000073573", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00104", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00104", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "433181", "url": "https://www.ncbi.nlm.nih.gov/gene/433181", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001404", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001404", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0003948", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003948", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR002350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:433181", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433181", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3588289", "url": "http://www.informatics.jax.org/marker/MGI:3588289", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PVCANDR", "url": "https://omabrowser.org/oma/group/PVCANDR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4768473at2759", "url": "http://www.orthodb.org/?query=4768473at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21312", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21312", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21312:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21312:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00050", "url": "http://pfam.xfam.org/family/PF00050", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q09TK7", "url": "http://purl.obolibrary.org/obo/PR_Q09TK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001041682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001041682", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4J158", "url": "https://www.uniprot.org/uniprot/A0A0R4J158", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J158-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J158-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q09TK7-1", "url": "https://www.uniprot.org/uniprot/Q09TK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSTWIKFLFILTLVLLPYFVAESAVASPESLRKVPNCTLYKSESDCSRTLIPVCADNQMTYYNACYFCLEQLVSPIKYKYHGICTKE", "length": 88, "header": "sp|Q09TK7-1|ISK11_MOUSE Isoform 1 of Serine protease inhibitor Kazal-type 11 OS=Mus musculus OX=10090 GN=Spink11 PE=2 SV=2 CANONICAL=Q09TK7-1" }, "isoforms": [ { "isoform_ac": "A0A0R4J158-1", "url": "", "sequence": { "sequence": "MCNEVEEQTVSTECWYIFISVFRFDKMSSTWIKFLFILTLVLLPYFVAESAVASPESLRKVPNCTLYKSESDCSRTLIPVCADNQMTYYNACYFCLEQLVSPIKYKYHGICTKE", "length": 114, "header": "tr|A0A0R4J158-1|ISK11_MOUSE Computationally mapped isoform of Serine protease inhibitor Kazal-type 11 OS=Mus musculus OX=10090 GN=Spink11 PE=2 SV=1 CANONICAL=Q09TK7-1" }, "locus": { "chromosome": "18", "start_pos": 44329244, "end_pos": 44323516, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000097587.5", "url": "https://www.ensembl.org/id/ENSMUST00000097587.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000095194.5", "url": "https://www.ensembl.org/id/ENSMUSP00000095194.5" } ] } }, { "isoform_ac": "Q09TK7-1", "url": "", "sequence": { "sequence": "MSSTWIKFLFILTLVLLPYFVAESAVASPESLRKVPNCTLYKSESDCSRTLIPVCADNQMTYYNACYFCLEQLVSPIKYKYHGICTKE", "length": 88, "header": "sp|Q09TK7-1|ISK11_MOUSE Isoform 1 of Serine protease inhibitor Kazal-type 11 OS=Mus musculus OX=10090 GN=Spink11 PE=2 SV=2 CANONICAL=Q09TK7-1" }, "locus": { "chromosome": "18", "start_pos": 44328768, "end_pos": 44323516, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000239421", "url": "https://www.ensembl.org/id/ENSMUST00000239421" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000159307", "url": "https://www.ensembl.org/id/ENSMUSP00000159307" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "Q09TK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q09TK7#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Novel epididymal protease inhibitors with Kazal or WAP family domain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Huhtaniemi I., Poutanen M., Jalkanen J., Kotimaeki M.", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "reference": [ { "type": "PubMed", "id": "16930550", "url": "https://glygen.org/publication/PubMed/16930550" } ] } ], "pathway": [ { "id": "mmu:433181", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433181", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "negative regulation of peptidase activity", "id": "GO:0010466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010466", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "Q09TK7", "url": "https://www.uniprot.org/uniprot/Q09TK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 37, "end_pos": 39, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }