{ "uniprot_canonical_ac": "Q08561-1", "uniprot_ac": "Q08561", "uniprot_id": "IES4_YEAST", "mass": { "chemical_mass": 13092.0, "monoisotopic_mass": 13092.0 }, "refseq": { "ac": "NP_014832", "name": "Ies4p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014832" }, "gene_names": [ { "name": "IES4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q08561", "id": "Q08561" }, { "name": "IES4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014832", "id": "NP_014832" } ], "protein_names": [ { "name": "Ino eighty subunit 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q08561" }, { "name": "Ies4p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014832", "id": "NP_014832" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "common_name": "Yeast" } ], "gene": [ { "name": "IES4", "url": "https://www.uniprot.org/uniprot/Q08561", "locus": {} } ], "crossref": [ { "id": "854361", "url": "https://www.ncbi.nlm.nih.gov/gene/854361", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q08561", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08561*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YOR189W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR189W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PWENSSK", "url": "https://omabrowser.org/oma/group/PWENSSK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2039480at2759", "url": "http://www.orthodb.org/?query=2039480at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "8A5A", "url": "https://www.rcsb.org/structure/8A5A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8A5O", "url": "https://www.rcsb.org/structure/8A5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_Q08561", "url": "http://purl.obolibrary.org/obo/PR_Q08561", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014832", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014832", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005715", "url": "https://www.yeastgenome.org/locus/S000005715", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q08561-1", "url": "https://www.uniprot.org/uniprot/Q08561-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQESSVLSESQEQLANNPKIEDTSPPSANSRDNSKPVLPWDYKNKAIEIKSFSGYKVNFTGWIRRDVREERQRGSEFTASDVKGSDDKATRKKEPADEDPEVKQLEKEGEDGLDS", "length": 116, "header": "sp|Q08561-1|IES4_YEAST Isoform 1 of Ino eighty subunit 4 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IES4 PE=1 SV=1 CANONICAL=Q08561-1" }, "isoforms": [ { "isoform_ac": "Q08561-1", "url": "", "sequence": { "sequence": "MSQESSVLSESQEQLANNPKIEDTSPPSANSRDNSKPVLPWDYKNKAIEIKSFSGYKVNFTGWIRRDVREERQRGSEFTASDVKGSDDKATRKKEPADEDPEVKQLEKEGEDGLDS", "length": 116, "header": "sp|Q08561-1|IES4_YEAST Isoform 1 of Ino eighty subunit 4 OS=Saccharomyces cerevisiae S288C OX=559292 GN=IES4 PE=1 SV=1 CANONICAL=Q08561-1" }, "locus": { "chromosome": "XV", "start_pos": 689971, "end_pos": 689624, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YOR189W_mRNA", "url": "https://www.ensembl.org/id/YOR189W_mRNA" }, { "database": "Ensembl Peptide", "id": "YOR189W", "url": "https://www.ensembl.org/id/YOR189W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q08561", "url": "https://www.yeastgenome.org/locus/Q08561" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ], "site_lbl": "Ser11" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr24" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "Q08561", "url": "https://www.yeastgenome.org/locus/Q08561" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser25" }, { "start_pos": 28, "end_pos": 28, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q08561", "url": "https://www.yeastgenome.org/locus/Q08561" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser28" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Ser2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q08561", "url": "https://www.yeastgenome.org/locus/Q08561" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ], "site_lbl": "Ser2" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser5" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser5" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser6" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser6" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser9" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ], "site_lbl": "Ser9" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q08561", "url": "https://www.yeastgenome.org/locus/Q08561" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ], "site_lbl": "Ser9" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Involvement of actin-related proteins in ATP-dependent chromatin remodeling.", "journal": "Mol. Cell", "date": "2003", "authors": "Wu C., Choi E., Shen X., Ranallo R.", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "reference": [ { "type": "PubMed", "id": "12887900", "url": "https://glygen.org/publication/PubMed/12887900" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Mec1/Tel1 phosphorylation of the INO80 chromatin remodeling complex influences DNA damage checkpoint responses.", "journal": "Cell", "date": "2007-08-10", "authors": "Morrison Ashby J, Kim Jung-Ae, Person Maria D, Highland Jessica, Xiao Jing, Wehr Tammy S, Hensley Sean, Bao Yunhe, Shen Jianjun, Collins Sean R, Weissman Jonathan S, Delrow Jeff, Krogan Nevan J, Haber James E, Shen Xuetong", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "17693258", "url": "https://glygen.org/publication/PubMed/17693258" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "A proteome-wide analysis of kinase-substrate network in the DNA damage response.", "journal": "The Journal of biological chemistry", "date": "2010-04-23", "authors": "Chen Sheng-hong, Albuquerque Claudio P, Liang Jason, Suhandynata Raymond T, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "20190278", "url": "https://glygen.org/publication/PubMed/20190278" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "reference": [ { "type": "PubMed", "id": "9169874", "url": "https://glygen.org/publication/PubMed/9169874" } ] } ], "pathway": [ { "id": "sce:YOR189W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR189W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" }, { "name": "Ino80 complex", "id": "GO:0031011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031011", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" }, { "name": "telomere maintenance via recombination", "id": "GO:0000722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000722", "evidence": [ { "database": "UniProtKB", "id": "Q08561", "url": "https://www.uniprot.org/uniprot/Q08561" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }