{
    "uniprot_canonical_ac": "Q08492-1",
    "uniprot_ac": "Q08492",
    "uniprot_id": "BUD21_YEAST",
    "mass": {
        "chemical_mass": 24385.0,
        "monoisotopic_mass": 24385.0
    },
    "refseq": {
        "ac": "NP_014721",
        "name": "Bud21p",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014721"
    },
    "gene_names": [
        {
            "name": "BUD21",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q08492",
            "id": "Q08492"
        },
        {
            "name": "BUD21",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014721",
            "id": "NP_014721"
        },
        {
            "name": "UTP16; YOR29-29",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014721",
            "id": "NP_014721"
        },
        {
            "name": "UTP16",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q08492",
            "id": "Q08492"
        },
        {
            "name": "YOR29-29",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q08492",
            "id": "Q08492"
        }
    ],
    "protein_names": [
        {
            "name": "Bud site selection protein 21",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q08492"
        },
        {
            "name": "Bud21p",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014721",
            "id": "NP_014721"
        },
        {
            "name": "U three protein 16",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q08492"
        },
        {
            "name": "U3 small nucleolar RNA-associated protein 16",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q08492"
        },
        {
            "name": "U3 snoRNA-associated protein 16",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q08492"
        }
    ],
    "function": [
        {
            "annotation": "Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in bud site selection maybe via the regulation of expression of bipolar budding components.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492#function"
                },
                {
                    "database": "PubMed",
                    "id": "12068309",
                    "url": "https://glygen.org/publication/PubMed/12068309"
                },
                {
                    "database": "PubMed",
                    "id": "11452010",
                    "url": "https://glygen.org/publication/PubMed/11452010"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "BUD21",
            "url": "https://www.uniprot.org/uniprot/Q08492",
            "locus": {
                "chromosome": "XV",
                "start_pos": 473369,
                "end_pos": 472725,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "YOR078W",
                        "url": "https://www.ensembl.org/id/YOR078W"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "854245",
            "url": "https://www.ncbi.nlm.nih.gov/gene/854245",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q08492",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08492*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR013268",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013268",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YOR078W",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR078W",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "KHIRLDE",
            "url": "https://omabrowser.org/oma/group/KHIRLDE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2033191at2759",
            "url": "http://www.orthodb.org/?query=2033191at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5WLC",
            "url": "https://www.rcsb.org/structure/5WLC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KE6",
            "url": "https://www.rcsb.org/structure/6KE6",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQP",
            "url": "https://www.rcsb.org/structure/6LQP",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQQ",
            "url": "https://www.rcsb.org/structure/6LQQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQR",
            "url": "https://www.rcsb.org/structure/6LQR",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQS",
            "url": "https://www.rcsb.org/structure/6LQS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQU",
            "url": "https://www.rcsb.org/structure/6LQU",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6LQV",
            "url": "https://www.rcsb.org/structure/6LQV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ND4",
            "url": "https://www.rcsb.org/structure/6ND4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ZQA",
            "url": "https://www.rcsb.org/structure/6ZQA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ZQB",
            "url": "https://www.rcsb.org/structure/6ZQB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ZQC",
            "url": "https://www.rcsb.org/structure/6ZQC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ZQD",
            "url": "https://www.rcsb.org/structure/6ZQD",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ZQE",
            "url": "https://www.rcsb.org/structure/6ZQE",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7AJT",
            "url": "https://www.rcsb.org/structure/7AJT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7AJU",
            "url": "https://www.rcsb.org/structure/7AJU",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7D4I",
            "url": "https://www.rcsb.org/structure/7D4I",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7D5S",
            "url": "https://www.rcsb.org/structure/7D5S",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7D63",
            "url": "https://www.rcsb.org/structure/7D63",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7SUK",
            "url": "https://www.rcsb.org/structure/7SUK",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF08297",
            "url": "http://pfam.xfam.org/family/PF08297",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q08492",
            "url": "http://purl.obolibrary.org/obo/PR_Q08492",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014721",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014721",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005604",
            "url": "https://www.yeastgenome.org/locus/S000005604",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q08492",
            "url": "https://www.uniprot.org/uniprot/Q08492",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q08492-1",
            "url": "https://www.uniprot.org/uniprot/Q08492-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSNGHVKFDADESQASASAVTDRQDDVLVISKKDKEVHSSSDEESDDDDAPQEEGLHSGKSEVESQITQREEAIRLEQSQLRSKRRKQNELYAKQKKSVNETEVTDEVIAELPEELLKNIDQKDEGSTQYSSSRHVTFDKLDESDENEEALAKAIKTKKRKTLKNLRKDSVKRGKFRVQLLSTTQDSKTLPPKKESSIIRSKDRWLNRKALNKG",
        "length": 214,
        "header": "sp|Q08492-1|BUD21_YEAST Isoform 1 of Bud site selection protein 21  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BUD21 PE=1 SV=1 CANONICAL=Q08492-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q08492-1",
            "url": "",
            "sequence": {
                "sequence": "MSNGHVKFDADESQASASAVTDRQDDVLVISKKDKEVHSSSDEESDDDDAPQEEGLHSGKSEVESQITQREEAIRLEQSQLRSKRRKQNELYAKQKKSVNETEVTDEVIAELPEELLKNIDQKDEGSTQYSSSRHVTFDKLDESDENEEALAKAIKTKKRKTLKNLRKDSVKRGKFRVQLLSTTQDSKTLPPKKESSIIRSKDRWLNRKALNKG",
                "length": 214,
                "header": "sp|Q08492-1|BUD21_YEAST Isoform 1 of Bud site selection protein 21  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BUD21 PE=1 SV=1 CANONICAL=Q08492-1"
            },
            "locus": {
                "chromosome": "XV",
                "start_pos": 473366,
                "end_pos": 472725,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YOR078W_mRNA",
                        "url": "https://www.ensembl.org/id/YOR078W_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YOR078W",
                        "url": "https://www.ensembl.org/id/YOR078W"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 128,
            "end_pos": 128,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "SGD",
                    "id": "Q08492",
                    "url": "https://www.yeastgenome.org/locus/Q08492"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Thr128"
        },
        {
            "start_pos": 13,
            "end_pos": 13,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "SGD",
                    "id": "Q08492",
                    "url": "https://www.yeastgenome.org/locus/Q08492"
                }
            ],
            "site_lbl": "Ser13"
        },
        {
            "start_pos": 144,
            "end_pos": 144,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "PubMed",
                    "id": "17330950",
                    "url": "https://glygen.org/publication/PubMed/17330950"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "17563356",
                    "url": "https://glygen.org/publication/PubMed/17563356"
                },
                {
                    "database": "PubMed",
                    "id": "19684113",
                    "url": "https://glygen.org/publication/PubMed/19684113"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                },
                {
                    "database": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                },
                {
                    "database": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                },
                {
                    "database": "SGD",
                    "id": "Q08492",
                    "url": "https://www.yeastgenome.org/locus/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser144"
        },
        {
            "start_pos": 16,
            "end_pos": 16,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "SGD",
                    "id": "Q08492",
                    "url": "https://www.yeastgenome.org/locus/Q08492"
                }
            ],
            "site_lbl": "Ser16"
        },
        {
            "start_pos": 39,
            "end_pos": 39,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                }
            ],
            "site_lbl": "Ser39"
        },
        {
            "start_pos": 40,
            "end_pos": 40,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                }
            ],
            "site_lbl": "Ser40"
        },
        {
            "start_pos": 41,
            "end_pos": 41,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                }
            ],
            "site_lbl": "Ser41"
        },
        {
            "start_pos": 45,
            "end_pos": 45,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "site_lbl": "Ser45"
        },
        {
            "start_pos": 65,
            "end_pos": 65,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                },
                {
                    "database": "SGD",
                    "id": "Q08492",
                    "url": "https://www.yeastgenome.org/locus/Q08492"
                }
            ],
            "site_lbl": "Ser65"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae.",
            "journal": "Mol. Biol. Cell",
            "date": "2001",
            "authors": "Snyder M., Ni L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11452010",
                    "url": "https://glygen.org/publication/PubMed/11452010"
                }
            ]
        },
        {
            "title": "A large nucleolar U3 ribonucleoprotein required for 18S ribosomal RNA biogenesis.",
            "journal": "Nature",
            "date": "2002",
            "authors": "Dragon F, Gallagher JE, Compagnone-Post PA, Mitchell BM, Porwancher KA, Wehner KA, Wormsley S, Settlage RE, Shabanowitz J, Osheim Y, Beyer AL, Hunt DF, Baserga SJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12068309",
                    "url": "https://glygen.org/publication/PubMed/12068309"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007-02-13",
            "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17287358",
                    "url": "https://glygen.org/publication/PubMed/17287358"
                }
            ]
        },
        {
            "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.",
            "journal": "Journal of proteome research",
            "date": "2007-03",
            "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17330950",
                    "url": "https://glygen.org/publication/PubMed/17330950"
                }
            ]
        },
        {
            "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007-06-19",
            "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17563356",
                    "url": "https://glygen.org/publication/PubMed/17563356"
                }
            ]
        },
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis.",
            "journal": "Genes & development",
            "date": "2009-08-15",
            "authors": "Huber Alexandre, Bodenmiller Bernd, Uotila Aino, Stahl Michael, Wanka Stefanie, Gerrits Bertran, Aebersold Ruedi, Loewith Robbie",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19684113",
                    "url": "https://glygen.org/publication/PubMed/19684113"
                }
            ]
        },
        {
            "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.",
            "journal": "Science (New York, N.Y.)",
            "date": "2009-09-25",
            "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                }
            ]
        },
        {
            "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.",
            "journal": "Proteomics",
            "date": "2009-10",
            "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                }
            ]
        },
        {
            "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.",
            "journal": "Molecular bioSystems",
            "date": "2009-11",
            "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                }
            ]
        },
        {
            "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.",
            "journal": "Molecular biology of the cell",
            "date": "2010-10-01",
            "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                }
            ]
        },
        {
            "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.",
            "journal": "BMC genomics",
            "date": "2010-12-02",
            "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21126336",
                    "url": "https://glygen.org/publication/PubMed/21126336"
                }
            ]
        },
        {
            "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.",
            "journal": "Science signaling",
            "date": "2010-12-21",
            "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21177495",
                    "url": "https://glygen.org/publication/PubMed/21177495"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08492",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "The sequence of a 54.7 kb fragment of yeast chromosome XV reveals the presence of two tRNAs and 24 new open reading frames.",
            "journal": "Yeast",
            "date": "1997",
            "authors": "Daignan-Fornier B., Bolotin-Fukuhara M., Bohn C., Dang V.-D., Valens M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9133743",
                    "url": "https://glygen.org/publication/PubMed/9133743"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08492",
                    "url": "https://www.uniprot.org/uniprot/Q08492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169874",
                    "url": "https://glygen.org/publication/PubMed/9169874"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YOR078W",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOR078W",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleolus",
                        "id": "GO:0005730",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "90S preribosome",
                        "id": "GO:0030686",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030686",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "small-subunit processome",
                        "id": "GO:0032040",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032040",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                        "id": "GO:0000447",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000447",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                        "id": "GO:0000472",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000472",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                        "id": "GO:0000462",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000462",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "maturation of SSU-rRNA",
                        "id": "GO:0030490",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030490",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "U3 snoRNA binding",
                        "id": "GO:0034511",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034511",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08492",
                                "url": "https://www.uniprot.org/uniprot/Q08492"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 100,
            "end_pos": 102,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 9
                },
                {
                    "field": "total_sites",
                    "count": 9
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 18
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}