{
    "uniprot_canonical_ac": "Q08278-1",
    "uniprot_ac": "Q08278",
    "uniprot_id": "MED7_YEAST",
    "mass": {
        "chemical_mass": 25585.0,
        "monoisotopic_mass": 25585.0
    },
    "refseq": {
        "ac": "NP_014506",
        "name": "mediator complex subunit MED7",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014506"
    },
    "gene_names": [
        {
            "name": "MED7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q08278",
            "id": "Q08278"
        },
        {
            "name": "MED7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014506",
            "id": "NP_014506"
        }
    ],
    "protein_names": [
        {
            "name": "Mediator of RNA polymerase II transcription subunit 7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q08278"
        },
        {
            "name": "Mediator complex subunit 7",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q08278"
        },
        {
            "name": "mediator complex subunit MED7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014506",
            "id": "NP_014506"
        }
    ],
    "function": [
        {
            "annotation": "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278#function"
                },
                {
                    "database": "PubMed",
                    "id": "11555651",
                    "url": "https://glygen.org/publication/PubMed/11555651"
                },
                {
                    "database": "PubMed",
                    "id": "16263706",
                    "url": "https://glygen.org/publication/PubMed/16263706"
                },
                {
                    "database": "PubMed",
                    "id": "16076843",
                    "url": "https://glygen.org/publication/PubMed/16076843"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "MED7",
            "url": "https://www.uniprot.org/uniprot/Q08278",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "853985",
            "url": "https://www.ncbi.nlm.nih.gov/gene/853985",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q08278",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08278*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR009244",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009244",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR037212",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR037212",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR044888",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR044888",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YOL135C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL135C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "KRLYPQH",
            "url": "https://omabrowser.org/oma/group/KRLYPQH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "11599at2759",
            "url": "http://www.orthodb.org/?query=11599at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR21428",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21428",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR21428:SF11",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21428:SF11",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1YKE",
            "url": "https://www.rcsb.org/structure/1YKE",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1YKH",
            "url": "https://www.rcsb.org/structure/1YKH",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3FBI",
            "url": "https://www.rcsb.org/structure/3FBI",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3FBN",
            "url": "https://www.rcsb.org/structure/3FBN",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5OQM",
            "url": "https://www.rcsb.org/structure/5OQM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5SVA",
            "url": "https://www.rcsb.org/structure/5SVA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UI9",
            "url": "https://www.rcsb.org/structure/7UI9",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIF",
            "url": "https://www.rcsb.org/structure/7UIF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIG",
            "url": "https://www.rcsb.org/structure/7UIG",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7UIO",
            "url": "https://www.rcsb.org/structure/7UIO",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF05983",
            "url": "http://pfam.xfam.org/family/PF05983",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q08278",
            "url": "http://purl.obolibrary.org/obo/PR_Q08278",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014506",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014506",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005495",
            "url": "https://www.yeastgenome.org/locus/S000005495",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q08278",
            "url": "https://www.uniprot.org/uniprot/Q08278",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q08278-1",
            "url": "https://www.uniprot.org/uniprot/Q08278-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ",
        "length": 222,
        "header": "sp|Q08278-1|MED7_YEAST Isoform 1 of Mediator of RNA polymerase II transcription subunit 7  OS=Saccharomyces cerevisiae S288C OX=559292 GN=MED7 PE=1 SV=1 CANONICAL=Q08278-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q08278-1",
            "url": "",
            "sequence": {
                "sequence": "MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQVHDKLTSIQDTLRTGSQSPPSSSQ",
                "length": 222,
                "header": "sp|Q08278-1|MED7_YEAST Isoform 1 of Mediator of RNA polymerase II transcription subunit 7  OS=Saccharomyces cerevisiae S288C OX=559292 GN=MED7 PE=1 SV=1 CANONICAL=Q08278-1"
            },
            "locus": {
                "chromosome": "XV",
                "start_pos": 70044,
                "end_pos": 69379,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YOL135C_mRNA",
                        "url": "https://www.ensembl.org/id/YOL135C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YOL135C",
                        "url": "https://www.ensembl.org/id/YOL135C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 214,
            "end_pos": 214,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "SGD",
                    "id": "Q08278",
                    "url": "https://www.yeastgenome.org/locus/Q08278"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08278",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08278"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser214"
        },
        {
            "start_pos": 216,
            "end_pos": 216,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08278",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08278"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "SGD",
                    "id": "Q08278",
                    "url": "https://www.yeastgenome.org/locus/Q08278"
                },
                {
                    "database": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ],
            "site_lbl": "Ser216"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The structural and functional organization of the yeast mediator complex.",
            "journal": "J. Biol. Chem.",
            "date": "2001",
            "authors": "Kim S.H., Kang J.S., Lee Y.C., Kim Y.-J., Han S.J., Hwang M.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11555651",
                    "url": "https://glygen.org/publication/PubMed/11555651"
                }
            ]
        },
        {
            "title": "Structure of the yeast RNA polymerase II holoenzyme: mediator conformation and polymerase interaction.",
            "journal": "Mol. Cell",
            "date": "2002",
            "authors": "Takagi Y., Davis J.A., Kornberg R.D., Asturias F.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12191485",
                    "url": "https://glygen.org/publication/PubMed/12191485"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Association of the Mediator complex with enhancers of active genes.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2003",
            "authors": "Kornberg R.D., Borggrefe T., Kuras L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14623974",
                    "url": "https://glygen.org/publication/PubMed/14623974"
                }
            ]
        },
        {
            "title": "A unified nomenclature for protein subunits of mediator complexes linking transcriptional regulators to RNA polymerase II.",
            "journal": "Mol. Cell",
            "date": "2004",
            "authors": "Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ, Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M, Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP, Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch AG, Holmberg S, Holstege FC, Jaehning JA, Kim YJ, Kuras L, Leutz A, Lis JT, Meisterernest M, Naar AM, Nasmyth K, Parvin JD, Ptashne M, Reinberg D, Ronne H, Sadowski I, Sakurai H, Sipiczki M, Sternberg PW, Stillman DJ, Strich R, Struhl K, Svejstrup JQ, Tuck S, Winston F, Roeder RG, Kornberg RD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15175151",
                    "url": "https://glygen.org/publication/PubMed/15175151"
                }
            ]
        },
        {
            "title": "A high resolution protein interaction map of the yeast Mediator complex.",
            "journal": "Nucleic Acids Res.",
            "date": "2004",
            "authors": "Werner M., van Berkum N.L., Bijma T., Holstege F.C.P., Bourbon H.-M., Boube M., Boschiero C., Guglielmi B., Klapholz B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15477388",
                    "url": "https://glygen.org/publication/PubMed/15477388"
                }
            ]
        },
        {
            "title": "A conserved mediator hinge revealed in the structure of the MED7-MED21 (Med7-Srb7) heterodimer.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Cramer P., Baumli S., Hoeppner S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15710619",
                    "url": "https://glygen.org/publication/PubMed/15710619"
                }
            ]
        },
        {
            "title": "Preponderance of free mediator in the yeast Saccharomyces cerevisiae.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Takagi Y., Davis J.A., Asturias F.J., Chadick J.Z.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16002404",
                    "url": "https://glygen.org/publication/PubMed/16002404"
                }
            ]
        },
        {
            "title": "Mediator and TFIIH govern carboxyl-terminal domain-dependent transcription in yeast extracts.",
            "journal": "J. Biol. Chem.",
            "date": "2005",
            "authors": "Kim Y., Nair D., Myers L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16076843",
                    "url": "https://glygen.org/publication/PubMed/16076843"
                }
            ]
        },
        {
            "title": "Mediator as a general transcription factor.",
            "journal": "J. Biol. Chem.",
            "date": "2006",
            "authors": "Takagi Y., Kornberg R.D.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16263706",
                    "url": "https://glygen.org/publication/PubMed/16263706"
                }
            ]
        },
        {
            "title": "Genome-wide location of the coactivator mediator: binding without activation and transient Cdk8 interaction on DNA.",
            "journal": "Mol. Cell",
            "date": "2006",
            "authors": "Werner M., van de Peppel J., Andrau J.-C., Bijma T., Holstege F.C.P., Koerkamp M.G., Lijnzaad P., van de Pasch L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16630888",
                    "url": "https://glygen.org/publication/PubMed/16630888"
                }
            ]
        },
        {
            "title": "Med19(Rox3) regulates intermodule interactions in the Saccharomyces cerevisiae mediator complex.",
            "journal": "J. Biol. Chem.",
            "date": "2007",
            "authors": "Baidoobonso S.M., Guidi B.W., Myers L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17192271",
                    "url": "https://glygen.org/publication/PubMed/17192271"
                }
            ]
        },
        {
            "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.",
            "journal": "Genome Res.",
            "date": "2007",
            "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17322287",
                    "url": "https://glygen.org/publication/PubMed/17322287"
                }
            ]
        },
        {
            "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.",
            "journal": "Proteomics",
            "date": "2009-10",
            "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08278",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                }
            ]
        },
        {
            "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.",
            "journal": "Molecular bioSystems",
            "date": "2009-11",
            "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08278",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                }
            ]
        },
        {
            "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.",
            "journal": "Nature methods",
            "date": "2013-07",
            "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08278",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23749301",
                    "url": "https://glygen.org/publication/PubMed/23749301"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 12 801 bp fragment of the left arm of yeast chromosome XV containing a putative 6-phosphofructo-2-kinase gene, a gene for a possible glycophospholipid-anchored surface protein and six other open reading frames.",
            "journal": "Yeast",
            "date": "1996",
            "authors": "Casas C., Herrero E., Arino J., Casamayor A., Khalid H., Piedrafita L., Aldea M., Balcells L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8896270",
                    "url": "https://glygen.org/publication/PubMed/8896270"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169874",
                    "url": "https://glygen.org/publication/PubMed/9169874"
                }
            ]
        },
        {
            "title": "The Med proteins of yeast and their function through the RNA polymerase II carboxy-terminal domain.",
            "journal": "Genes Dev.",
            "date": "1998",
            "authors": "Myers LC, Gustafsson CM, Bushnell DA, Lui M, Erdjument-Bromage H, Tempst P, Kornberg RD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08278",
                    "url": "https://www.uniprot.org/uniprot/Q08278"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9420330",
                    "url": "https://glygen.org/publication/PubMed/9420330"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YOL135C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL135C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O43513-1",
            "protein_name": "Mediator of RNA polymerase II transcription subunit 7",
            "gene_name": "MED7",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP",
                "length": 233
            },
            "evidence": [
                {
                    "id": "Q08278",
                    "url": "https://omabrowser.org/oma/group/Q08278/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9CZB6-1",
            "protein_name": "Mediator of RNA polymerase II transcription subunit 7",
            "gene_name": "Med7",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKAEPMDTDDNSNCPGQNEQQRESSGHRRDQIIEKDAALCVLIDEMNERP",
                "length": 233
            },
            "evidence": [
                {
                    "id": "Q08278",
                    "url": "https://omabrowser.org/oma/group/Q08278/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q9GYV9-1",
            "protein_name": "Mediator of RNA polymerase II transcription subunit 7",
            "gene_name": "MED7",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MSNQETQVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQKRQRVETAARFQKHLERVREIVNTAFSALPVLDDDDDSGGAKIKTEVDPLEANAAAKNDPSYQHDRMLCKLVDAIE",
                "length": 220
            },
            "evidence": [
                {
                    "id": "Q08278",
                    "url": "https://omabrowser.org/oma/group/Q08278/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 6,
                "go_terms": [
                    {
                        "name": "positive regulation of transcription initiation by RNA polymerase II",
                        "id": "GO:0060261",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060261",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of transcription by RNA polymerase II",
                        "id": "GO:0000122",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of transcription by RNA polymerase II",
                        "id": "GO:0006357",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription by RNA polymerase II",
                        "id": "GO:0045944",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription elongation by RNA polymerase II",
                        "id": "GO:0032968",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032968",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II preinitiation complex assembly",
                        "id": "GO:0051123",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051123",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mediator complex",
                        "id": "GO:0016592",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016592",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "core mediator complex",
                        "id": "GO:0070847",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070847",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "transcription coregulator activity",
                        "id": "GO:0003712",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003712",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08278",
                                "url": "https://www.uniprot.org/uniprot/Q08278"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 107,
            "end_pos": 109,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 48,
            "end_pos": 50,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 21
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}