{
    "uniprot_canonical_ac": "Q08235-1",
    "uniprot_ac": "Q08235",
    "uniprot_id": "BRX1_YEAST",
    "mass": {
        "chemical_mass": 33531.0,
        "monoisotopic_mass": 33531.0
    },
    "refseq": {
        "ac": "NP_014565",
        "name": "ribosome biogenesis protein BRX1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014565"
    },
    "gene_names": [
        {
            "name": "BRX1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q08235",
            "id": "Q08235"
        },
        {
            "name": "BRX1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014565",
            "id": "NP_014565"
        }
    ],
    "protein_names": [
        {
            "name": "Ribosome biogenesis protein BRX1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q08235"
        },
        {
            "name": "ribosome biogenesis protein BRX1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014565",
            "id": "NP_014565"
        }
    ],
    "function": [
        {
            "annotation": "Required for biogenesis of the 60S ribosomal subunit.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235#function"
                },
                {
                    "database": "PubMed",
                    "id": "11843177",
                    "url": "https://glygen.org/publication/PubMed/11843177"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "BRX1",
            "url": "https://www.uniprot.org/uniprot/Q08235",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "854078",
            "url": "https://www.ncbi.nlm.nih.gov/gene/854078",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q08235",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08235*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR007109",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007109",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR026532",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR026532",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YOL077C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL077C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "HVFTFTY",
            "url": "https://omabrowser.org/oma/group/HVFTFTY/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5481228at2759",
            "url": "http://www.orthodb.org/?query=5481228at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR13634",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13634",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR13634:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13634:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5Z1G",
            "url": "https://www.rcsb.org/structure/5Z1G",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5Z3G",
            "url": "https://www.rcsb.org/structure/5Z3G",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6C0F",
            "url": "https://www.rcsb.org/structure/6C0F",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6CB1",
            "url": "https://www.rcsb.org/structure/6CB1",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ELZ",
            "url": "https://www.rcsb.org/structure/6ELZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EM1",
            "url": "https://www.rcsb.org/structure/6EM1",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EM3",
            "url": "https://www.rcsb.org/structure/6EM3",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EM4",
            "url": "https://www.rcsb.org/structure/6EM4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6EM5",
            "url": "https://www.rcsb.org/structure/6EM5",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7NAC",
            "url": "https://www.rcsb.org/structure/7NAC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7OHR",
            "url": "https://www.rcsb.org/structure/7OHR",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7OHS",
            "url": "https://www.rcsb.org/structure/7OHS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7OHV",
            "url": "https://www.rcsb.org/structure/7OHV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7OHW",
            "url": "https://www.rcsb.org/structure/7OHW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7R6K",
            "url": "https://www.rcsb.org/structure/7R6K",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7R7A",
            "url": "https://www.rcsb.org/structure/7R7A",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7R7C",
            "url": "https://www.rcsb.org/structure/7R7C",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8E5T",
            "url": "https://www.rcsb.org/structure/8E5T",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF04427",
            "url": "http://pfam.xfam.org/family/PF04427",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q08235",
            "url": "http://purl.obolibrary.org/obo/PR_Q08235",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_014565",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014565",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000005437",
            "url": "https://www.yeastgenome.org/locus/S000005437",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q08235",
            "url": "https://www.uniprot.org/uniprot/Q08235",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q08235-1",
            "url": "https://www.uniprot.org/uniprot/Q08235-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSSIYKALAGKSKDNKSEKKQGNVKQFMNKQRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQNLHTMDELNFTGNCLKGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTYEISHSTKNKEEYEDGEEDISLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVVRAQIKQQAAEEAKSRAEAAVERKIKRRENVLAADPLSNDALFK",
        "length": 291,
        "header": "sp|Q08235-1|BRX1_YEAST Isoform 1 of Ribosome biogenesis protein BRX1  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BRX1 PE=1 SV=2 CANONICAL=Q08235-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q08235-1",
            "url": "",
            "sequence": {
                "sequence": "MSSIYKALAGKSKDNKSEKKQGNVKQFMNKQRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQNLHTMDELNFTGNCLKGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTYEISHSTKNKEEYEDGEEDISLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVVRAQIKQQAAEEAKSRAEAAVERKIKRRENVLAADPLSNDALFK",
                "length": 291,
                "header": "sp|Q08235-1|BRX1_YEAST Isoform 1 of Ribosome biogenesis protein BRX1  OS=Saccharomyces cerevisiae S288C OX=559292 GN=BRX1 PE=1 SV=2 CANONICAL=Q08235-1"
            },
            "locus": {
                "chromosome": "XV",
                "start_pos": 186723,
                "end_pos": 185851,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YOL077C_mRNA",
                        "url": "https://www.ensembl.org/id/YOL077C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YOL077C",
                        "url": "https://www.ensembl.org/id/YOL077C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 285,
            "end_pos": 285,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                },
                {
                    "database": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                },
                {
                    "database": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                },
                {
                    "database": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                },
                {
                    "database": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                },
                {
                    "database": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                },
                {
                    "database": "SGD",
                    "id": "Q08235",
                    "url": "https://www.yeastgenome.org/locus/Q08235"
                }
            ],
            "site_lbl": "Ser285"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Brix from Xenopus laevis and brx1p from yeast define a new family of proteins involved in the biogenesis of large ribosomal subunits.",
            "journal": "Biol. Chem.",
            "date": "2001",
            "authors": "Bogengruber E., Breitenbach M., Doppler E., Hallegger M., Jantsch M., Kaser A., Kreil G., Lepperdinger G.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11843177",
                    "url": "https://glygen.org/publication/PubMed/11843177"
                }
            ]
        },
        {
            "title": "Global analysis of protein localization in budding yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562095",
                    "url": "https://glygen.org/publication/PubMed/14562095"
                }
            ]
        },
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2008-07",
            "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18407956",
                    "url": "https://glygen.org/publication/PubMed/18407956"
                }
            ]
        },
        {
            "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.",
            "journal": "Science (New York, N.Y.)",
            "date": "2009-09-25",
            "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19779198",
                    "url": "https://glygen.org/publication/PubMed/19779198"
                }
            ]
        },
        {
            "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.",
            "journal": "Proteomics",
            "date": "2009-10",
            "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19795423",
                    "url": "https://glygen.org/publication/PubMed/19795423"
                }
            ]
        },
        {
            "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.",
            "journal": "Molecular bioSystems",
            "date": "2009-11",
            "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19823750",
                    "url": "https://glygen.org/publication/PubMed/19823750"
                }
            ]
        },
        {
            "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.",
            "journal": "Molecular biology of the cell",
            "date": "2010-10-01",
            "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q08235",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20702584",
                    "url": "https://glygen.org/publication/PubMed/20702584"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169874",
                    "url": "https://glygen.org/publication/PubMed/9169874"
                }
            ]
        },
        {
            "title": "Sequence analysis of a 33.2 kb segment from the left arm of yeast chromosome XV reveals eight known genes and ten new open reading frames including homologues of ABC transporters, inositol phosphatases and human expressed sequence tags.",
            "journal": "Yeast",
            "date": "1997",
            "authors": "Alexandraki D., Tzermia M., Katsoulou C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q08235",
                    "url": "https://www.uniprot.org/uniprot/Q08235"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9178509",
                    "url": "https://glygen.org/publication/PubMed/9178509"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YOL077C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL077C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q8TDN6-1",
            "protein_name": "Ribosome biogenesis protein BRX1 homolog",
            "gene_name": "BRIX1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAATKRKRRGGFAVQAKKPKRNEIDAEPPAKRHATAEEVEEEERDRIPGPVCKGKWKNKERILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQRMDSGKTK",
                "length": 353
            },
            "evidence": [
                {
                    "id": "Q08235",
                    "url": "https://omabrowser.org/oma/group/Q08235/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9DCA5-1",
            "protein_name": "Ribosome biogenesis protein BRX1 homolog",
            "gene_name": "Brix1",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAATKRKRRGGLEVQAKKPKRSSKDAGQPAKQADVAKEAEEENRDRIPGPVCKGKWKNKERILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYALLKEFLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYRERQQVKDVQKLRKKEPKTILPHDPTADVFVIPAEEKPVEIQWVKPEPKVDLKARKRRIYKRHRKLQQKMSRGSAK",
                "length": 353
            },
            "evidence": [
                {
                    "id": "Q08235",
                    "url": "https://omabrowser.org/oma/group/Q08235/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "RNA binding",
                        "id": "GO:0003723",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "5S rRNA binding",
                        "id": "GO:0008097",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008097",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "rRNA primary transcript binding",
                        "id": "GO:0042134",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042134",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleolus",
                        "id": "GO:0005730",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "preribosome, large subunit precursor",
                        "id": "GO:0030687",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030687",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "ribosomal large subunit assembly",
                        "id": "GO:0000027",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000027",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                        "id": "GO:0000464",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000464",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                        "id": "GO:0000465",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000465",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q08235",
                                "url": "https://www.uniprot.org/uniprot/Q08235"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 124,
            "end_pos": 126,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 15,
            "end_pos": 17,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 11
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}