{ "uniprot_canonical_ac": "Q08176-1", "uniprot_ac": "Q08176", "uniprot_id": "MIM1_YEAST", "mass": { "chemical_mass": 12758.0, "monoisotopic_mass": 12758.0 }, "refseq": { "ac": "NP_014616", "name": "Mim1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014616" }, "gene_names": [ { "name": "MIM1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q08176", "id": "Q08176" }, { "name": "MIM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014616", "id": "NP_014616" }, { "name": "TOM13", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014616", "id": "NP_014616" }, { "name": "TOM13", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q08176", "id": "Q08176" } ], "protein_names": [ { "name": "Mitochondrial import protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q08176" }, { "name": "Mim1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014616", "id": "NP_014616" }, { "name": "Mitochondrial 13 kDa outer membrane protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q08176" } ], "function": [ { "annotation": "Component of the MIM complex required for mitochondrial outer membrane protein import (PubMed:22467864). The MIM complex cooperates with the receptor TOM70 in binding of precursor proteins and promotes their insertion and assembly into the outer membrane (PubMed:21825073). Involved in import of the subset of proteins with multiple alpha-helical transmembrane segments, including UGO1 (PubMed:21825073, PubMed:21825074). Required for the assembly of the TOM (translocase of outer membrane) receptor complex, which is responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins (PubMed:15242642, PubMed:15326197, PubMed:15608614). Required specifically for assembly of TOM40, TOM20, and TOM70, but not TOM22 (PubMed:17974559, PubMed:18187149).", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176#function" }, { "database": "PubMed", "id": "21825073", "url": "https://glygen.org/publication/PubMed/21825073" }, { "database": "PubMed", "id": "18187149", "url": "https://glygen.org/publication/PubMed/18187149" }, { "database": "PubMed", "id": "22467864", "url": "https://glygen.org/publication/PubMed/22467864" }, { "database": "PubMed", "id": "15608614", "url": "https://glygen.org/publication/PubMed/15608614" }, { "database": "PubMed", "id": "15326197", "url": "https://glygen.org/publication/PubMed/15326197" }, { "database": "PubMed", "id": "15242642", "url": "https://glygen.org/publication/PubMed/15242642" }, { "database": "PubMed", "id": "17974559", "url": "https://glygen.org/publication/PubMed/17974559" }, { "database": "PubMed", "id": "21825074", "url": "https://glygen.org/publication/PubMed/21825074" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MIM1", "url": "https://www.uniprot.org/uniprot/Q08176", "locus": { "chromosome": "XV", "start_pos": 274012, "end_pos": 274353, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YOL026C", "url": "https://www.ensembl.org/id/YOL026C" } ] } } ], "crossref": [ { "id": "854131", "url": "https://www.ncbi.nlm.nih.gov/gene/854131", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q08176", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08176*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013262", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013262", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YOL026C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL026C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1354721at2759", "url": "http://www.orthodb.org/?query=1354721at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28241", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28241", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28241:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28241:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08219", "url": "http://pfam.xfam.org/family/PF08219", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q08176", "url": "http://purl.obolibrary.org/obo/PR_Q08176", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_014616", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_014616", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000005386", "url": "https://www.yeastgenome.org/locus/S000005386", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q08176-1", "url": "https://www.uniprot.org/uniprot/Q08176-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTEVVGFWESVSDDESEDKDCMEVQNTVSADESPLVQSLVSFVGSCSINLLLPFLNGMMLGFGELFAHELCWRFNWFNHRNKGYKVYPESRKIAALKEISSPGTRGRVASKFL", "length": 113, "header": "sp|Q08176-1|MIM1_YEAST Isoform 1 of Mitochondrial import protein 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIM1 PE=1 SV=1 CANONICAL=Q08176-1" }, "isoforms": [ { "isoform_ac": "Q08176-1", "url": "", "sequence": { "sequence": "MTEVVGFWESVSDDESEDKDCMEVQNTVSADESPLVQSLVSFVGSCSINLLLPFLNGMMLGFGELFAHELCWRFNWFNHRNKGYKVYPESRKIAALKEISSPGTRGRVASKFL", "length": 113, "header": "sp|Q08176-1|MIM1_YEAST Isoform 1 of Mitochondrial import protein 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=MIM1 PE=1 SV=1 CANONICAL=Q08176-1" }, "locus": { "chromosome": "XV", "start_pos": 274353, "end_pos": 274015, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YOL026C_mRNA", "url": "https://www.ensembl.org/id/YOL026C_mRNA" }, { "database": "Ensembl Peptide", "id": "YOL026C", "url": "https://www.ensembl.org/id/YOL026C" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08176", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08176" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "Q08176", "url": "https://www.yeastgenome.org/locus/Q08176" } ], "site_lbl": "Ser90" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Exploration of essential gene functions via titratable promoter alleles.", "journal": "Cell", "date": "2004", "authors": "Li Z., Yang X., Zhang W., Krogan N.J., Lopez A., Greenblatt J.F., Moffat J., Roberts C.J., Chua G., Hughes T.R., Boone C., Morris Q., Haynes J., Davierwala A.P., Mnaimneh S., Pootoolal J., Andrews B.J., Hiley S.L., Kaiser C.A., Grigull J., Mitsakakis N., Morse D., Peng W.-T., Trochesset M.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "15242642", "url": "https://glygen.org/publication/PubMed/15242642" } ] }, { "title": "Two novel proteins in the mitochondrial outer membrane mediate beta-barrel protein assembly.", "journal": "J. Cell Biol.", "date": "2004", "authors": "Ishikawa Daigo, Yamamoto Hayashi, Tamura Yasushi, Moritoh Kaori, Endo Toshiya", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "15326197", "url": "https://glygen.org/publication/PubMed/15326197" } ] }, { "title": "Mim1, a protein required for the assembly of the TOM complex of mitochondria.", "journal": "EMBO Rep.", "date": "2005", "authors": "Schmitt S., Rapaport D., Neupert W., Waizenegger T., Zivkovic J.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "15608614", "url": "https://glygen.org/publication/PubMed/15608614" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Biogenesis of the mitochondrial TOM complex: Mim1 promotes insertion and assembly of signal-anchored receptors.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Stojanovski D., Becker T., Guiard B., Meisinger C., Pfanner N., Milenkovic D., Pfannschmidt S., Wiedemann N., Kutik S.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "17974559", "url": "https://glygen.org/publication/PubMed/17974559" } ] }, { "title": "The transmembrane segment of Tom20 is recognized by Mim1 for docking to the mitochondrial TOM complex.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Gooley P.R., Lithgow T., Chan N.C., Hulett J.M., Likic V.A., Lueder F., Perry A.J., Wolynec P.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "18187149", "url": "https://glygen.org/publication/PubMed/18187149" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "Q08176", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08176" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "The mitochondrial import protein Mim1 promotes biogenesis of multispanning outer membrane proteins.", "journal": "J. Cell Biol.", "date": "2011", "authors": "Becker T., Chacinska A., Guiard B., Lithgow T., Meisinger C., Mueller J.M., Pfanner N., Wagner R., Zufall N., Lehmann W., Goroncy L., Krueger V., Wenz L.S.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "21825073", "url": "https://glygen.org/publication/PubMed/21825073" } ] }, { "title": "Multispan mitochondrial outer membrane protein Ugo1 follows a unique Mim1-dependent import pathway.", "journal": "J. Cell Biol.", "date": "2011", "authors": "Rapaport D., Dimmer K.S., Dukanovic J., Krumpe K., Papic D.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "21825074", "url": "https://glygen.org/publication/PubMed/21825074" } ] }, { "title": "A crucial role for Mim2 in the biogenesis of mitochondrial outer membrane proteins.", "journal": "J. Cell Sci.", "date": "2012", "authors": "Rapaport D., Dimmer K.S., Krumpe K., Papic D., Schumann B., Sperl D., Walther D.M.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "22467864", "url": "https://glygen.org/publication/PubMed/22467864" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Mewes H.-W., Wambutt R., Wedler H., Wiemann S., Pujol A., Uhlen M., Camasses A., Poch O., Benes V., Durand P., Vlcek C., Winsor B., Landt O., Portetelle D., Casas C., Lafuente M.J., Paces V., Delius H., Michaux G., Schweizer M., Feldmann H., Kleine K., Martin R.P., Hofmann B., Schwager C., Voss H., Cziepluch C., Jauniaux J.-C., Hughes B., Galisson F., Volckaert G., Hattenhorst U., Cheret G., Sor F., Herrero E., Arino J., Vetter I., Casamayor A., Bordonne R., Perrin A., Thierry A., Kordes E., Louis E.J., Hollenberg C.P., Maarse A.C., Marck C., Vandenbol M., Pohl T.M., Tobiasch E., Pearson B.M., Poirey R., Hand N.J., Goulding S.E., Daignan-Fornier B., Dujon B., Goffeau A., Grivell L.A., Hani J., Hernando Y., Hilger F., Madania A., Mannhaupt G., Zollner A., Aldea M., Alexandraki D., Bolotin-Fukuhara M., Fairhead C., Gancedo C., Purnelle B., Ramezani Rad M., Tarassov I.A., Tzermia M., Voet M., Albermann K., Bohn C., Boyer J., Dang V.-D., Gaillon L., Gamo F.-J., Habbig B., Hebling U., Heumann K., Hiesel R., Kalogeropoulos A., Katsoulou C., Parle-McDermott A.G., Pettersson B., Rechmann S., Sterky F., Teodoru C., Tettelin H., Unseld M., Valens M., Wolfe K.H., Zumstein E., de Haan M.", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "reference": [ { "type": "PubMed", "id": "9169874", "url": "https://glygen.org/publication/PubMed/9169874" } ] } ], "pathway": [ { "id": "sce:YOL026C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YOL026C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein insertion into mitochondrial outer membrane", "id": "GO:0045040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045040", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "pmid": "" }, { "name": "mitochondrial outer membrane translocase complex assembly", "id": "GO:0070096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070096", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q08176", "url": "https://www.uniprot.org/uniprot/Q08176" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }