{ "uniprot_canonical_ac": "Q08093-1", "uniprot_ac": "Q08093", "uniprot_id": "CNN2_MOUSE", "mass": { "chemical_mass": 33156.0, "monoisotopic_mass": 33156.0 }, "refseq": { "ac": "NP_031751", "name": "calponin-2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, "gene_names": [ { "name": "Cnn2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q08093", "id": "Q08093" }, { "name": "Calpo2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751", "id": "NP_031751" }, { "name": "Cnn2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751", "id": "NP_031751" } ], "protein_names": [ { "name": "Calponin-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q08093" }, { "name": "Calponin H2, smooth muscle", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q08093" }, { "name": "Neutral calponin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q08093" }, { "name": "calponin-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751", "id": "NP_031751" }, { "name": "neutral calponin; calponin H2, smooth muscle; h2-calponin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751", "id": "NP_031751" } ], "function": [ { "annotation": "A rapid degradation of calponin 2 is required for cytokinesis.", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, { "database": "PubMed", "id": "34133238", "url": "https://glygen.org/publication/PubMed/34133238" } ] }, { "annotation": "Calponin 2 harnesses metabolic reprogramming to determine kidney fibrosis.", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, { "database": "PubMed", "id": "36963615", "url": "https://glygen.org/publication/PubMed/36963615" } ] }, { "annotation": "Deletion of Calponin 2 Reduces the Formation of Postoperative Peritoneal Adhesions.", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, { "database": "PubMed", "id": "33622156", "url": "https://glygen.org/publication/PubMed/33622156" } ] }, { "annotation": "Expressed h2-calponin is associated with actin-tropomyosin microfilaments and may regulate cytokinesis by inhibiting the activity of the actin cytoskeleton.", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, { "database": "PubMed", "id": "12388067", "url": "https://glygen.org/publication/PubMed/12388067" } ] }, { "annotation": "Loss of Calponin 2 causes age-progressive proteinuria in mice.", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" }, { "database": "PubMed", "id": "36117313", "url": "https://glygen.org/publication/PubMed/36117313" } ] }, { "annotation": "Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.", "evidence": [ { "database": "UniProtKB", "id": "D3Z7R6", "url": "https://www.uniprot.org/uniprot/D3Z7R6#function" }, { "database": "UniProtKB", "id": "RU361224", "url": "https://www.uniprot.org/uniprot/RU361224#function" }, { "database": "UniProtKB", "id": "ARBA00025109", "url": "https://www.uniprot.org/uniprot/ARBA00025109#function" }, { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cnn2", "url": "https://www.uniprot.org/uniprot/Q08093", "locus": { "chromosome": "10", "start_pos": 79831896, "end_pos": 79824418, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000004665", "url": "https://www.ensembl.org/id/ENSMUSG00000004665" } ] } } ], "crossref": [ { "id": "ENSMUSG00000004665", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000004665", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd21283", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21283", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "12798", "url": "https://www.ncbi.nlm.nih.gov/gene/12798", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q08093", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08093*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000557", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000557", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001715", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001715", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001997", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001997", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003096", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003096", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036872", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036872", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12798", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12798", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "105093", "url": "http://www.informatics.jax.org/marker/MGI:105093", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EIGPDFQ", "url": "https://omabrowser.org/oma/group/EIGPDFQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "11630at2759", "url": "http://www.orthodb.org/?query=11630at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47385", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47385", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47385:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47385:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47385:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47385:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00307", "url": "http://pfam.xfam.org/family/PF00307", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00402", "url": "http://pfam.xfam.org/family/PF00402", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q08093", "url": "http://purl.obolibrary.org/obo/PR_Q08093", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D3Z7R6", "url": "https://www.uniprot.org/uniprot/D3Z7R6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z7R6-1", "url": "https://www.uniprot.org/uniprot/D3Z7R6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q08093-1", "url": "https://www.uniprot.org/uniprot/Q08093-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQEEAGY", "length": 305, "header": "sp|Q08093-1|CNN2_MOUSE Isoform 1 of Calponin-2 OS=Mus musculus OX=10090 GN=Cnn2 PE=1 SV=1 CANONICAL=Q08093-1" }, "isoforms": [ { "isoform_ac": "D3Z7R6-1", "url": "", "sequence": { "sequence": "MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQEEAGY", "length": 266, "header": "tr|D3Z7R6-1|D3Z7R6_MOUSE Computationally mapped isoform of Calponin OS=Mus musculus OX=10090 GN=Cnn2 PE=1 SV=1 CANONICAL=Q08093-1" }, "locus": { "chromosome": "10", "start_pos": 79830445, "end_pos": 79824512, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105374.2", "url": "https://www.ensembl.org/id/ENSMUST00000105374.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101013.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101013.2" } ] } }, { "isoform_ac": "Q08093-1", "url": "", "sequence": { "sequence": "MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQEEAGY", "length": 305, "header": "sp|Q08093-1|CNN2_MOUSE Isoform 1 of Calponin-2 OS=Mus musculus OX=10090 GN=Cnn2 PE=1 SV=1 CANONICAL=Q08093-1" }, "locus": { "chromosome": "10", "start_pos": 79830445, "end_pos": 79824512, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000004784", "url": "https://www.ensembl.org/id/ENSMUST00000004784" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000004784", "url": "https://www.ensembl.org/id/ENSMUSP00000004784" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q08093", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" }, { "id": "28528544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28528544" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" }, { "id": "28135057", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28135057" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "21540332", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21540332" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" }, { "id": "24788674", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24788674" } ] } ], "phosphorylation": [ { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "site_lbl": "Ser138" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Developmentally regulated expression of calponin isoforms and the effect of h2-calponin on cell proliferation.", "journal": "American journal of physiology. Cell physiology", "date": "2003", "authors": "Hossain MM, Hwang DY, Huang QQ, Sasaki Y, Jin JP", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" } ], "reference": [ { "type": "PubMed", "id": "12388067", "url": "https://glygen.org/publication/PubMed/12388067" } ] }, { "title": "Chemical reporters for fluorescent detection and identification of O-GlcNAc-modified proteins reveal glycosylation of the ubiquitin ligase NEDD4-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Zaro BW, Yang YY, Hang HC, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "21540332", "url": "https://glygen.org/publication/PubMed/21540332" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" }, { "database": "UniProtKB", "id": "D3Z7R6", "url": "https://www.uniprot.org/uniprot/D3Z7R6" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Identification of O-GlcNAc modification targets in mouse retinal pericytes: implication of p53 in pathogenesis of diabetic retinopathy.", "journal": "PloS one", "date": "2014", "authors": "Gurel Z, Zaro BW, Pratt MR, Sheibani N", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "24788674", "url": "https://glygen.org/publication/PubMed/24788674" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "The Small Molecule 2-Azido-2-deoxy-glucose Is a Metabolic Chemical Reporter of O-GlcNAc Modifications in Mammalian Cells, Revealing an Unexpected Promiscuity of O-GlcNAc Transferase.", "journal": "ACS chemical biology", "date": "2017", "authors": "Zaro BW, Batt AR, Chuh KN, Navarro MX, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "28135057", "url": "https://glygen.org/publication/PubMed/28135057" } ] }, { "title": "The New Chemical Reporter 6-Alkynyl-6-deoxy-GlcNAc Reveals O-GlcNAc Modification of the Apoptotic Caspases That Can Block the Cleavage/Activation of Caspase-8.", "journal": "Journal of the American Chemical Society", "date": "2017", "authors": "Chuh KN, Batt AR, Zaro BW, Darabedian N, Marotta NP, Brennan CK, Amirhekmat A, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "28528544", "url": "https://glygen.org/publication/PubMed/28528544" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q08093", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08093" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Deletion of Calponin 2 Reduces the Formation of Postoperative Peritoneal Adhesions.", "journal": "Journal of investigative surgery : the official journal of the Academy of Surgical Research", "date": "2022", "authors": "Hsieh TB, Feng HZ, Jin JP", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" } ], "reference": [ { "type": "PubMed", "id": "33622156", "url": "https://glygen.org/publication/PubMed/33622156" } ] }, { "title": "A rapid degradation of calponin 2 is required for cytokinesis.", "journal": "American journal of physiology. Cell physiology", "date": "2021", "authors": "Qian A, Hsieh TB, Hossain MM, Lin JJ, Jin JP", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" } ], "reference": [ { "type": "PubMed", "id": "34133238", "url": "https://glygen.org/publication/PubMed/34133238" } ] }, { "title": "Loss of Calponin 2 causes age-progressive proteinuria in mice.", "journal": "Physiological reports", "date": "2022", "authors": "Hsieh TB, Jin JP", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" } ], "reference": [ { "type": "PubMed", "id": "36117313", "url": "https://glygen.org/publication/PubMed/36117313" } ] }, { "title": "Calponin 2 harnesses metabolic reprogramming to determine kidney fibrosis.", "journal": "Molecular metabolism", "date": "2023-05", "authors": "Gui Yuan, Wang Yuanyuan, Palanza Zachary, Wang Jack L, Gupta Priya, Tao Jianling, Qiao Yi, Hargis Geneva, Kreutzer Donald L, Bastacky Sheldon I, Yu Yanbao, Wang Yanlin, Liu Silvia, Fu Haiyan, Zhou Dong", "evidence": [ { "database": "RefSeq", "id": "NP_031751", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031751" } ], "reference": [ { "type": "PubMed", "id": "36963615", "url": "https://glygen.org/publication/PubMed/36963615" } ] }, { "title": "Mammalian calponin. Identification and expression of genetic variants.", "journal": "FEBS Lett.", "date": "1993", "authors": "Small J.V., Gimona M., Strasser P., Herzog M., Moessler H.", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "reference": [ { "type": "PubMed", "id": "8370452", "url": "https://glygen.org/publication/PubMed/8370452" } ] } ], "pathway": [ { "id": "mmu:12798", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12798", "resource": "KEGG Pathway" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q99439-1", "protein_name": "Calponin-2", "gene_name": "CNN2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY", "length": 309 }, "evidence": [ { "id": "45227980", "url": "http://www.informatics.jax.org/homology/45227980", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "negative regulation of macrophage migration", "id": "GO:1905522", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905522", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "actomyosin structure organization", "id": "GO:0031032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031032", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "hemopoiesis", "id": "GO:0030097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030097", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "negative regulation of phagocytosis", "id": "GO:0050765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050765", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "wound healing", "id": "GO:0042060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042060", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "regulation of actin filament-based process", "id": "GO:0032970", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032970", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "establishment of localization in cell", "id": "GO:0051649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "macrophage migration", "id": "GO:1905517", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905517", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "regulation of leukocyte proliferation", "id": "GO:0070663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070663", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "calmodulin binding", "id": "GO:0005516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005516", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" }, { "name": "stress fiber", "id": "GO:0001725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001725", "evidence": [ { "database": "UniProtKB", "id": "Q08093", "url": "https://www.uniprot.org/uniprot/Q08093" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 242, "end_pos": 244, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }