{ "uniprot_canonical_ac": "Q08045-1", "uniprot_ac": "Q08045", "uniprot_id": "LCL2_YEAST", "mass": { "chemical_mass": 14922.0, "monoisotopic_mass": 14922.0 }, "refseq": { "ac": "NP_013205", "name": "Lcl2p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013205" }, "gene_names": [ { "name": "LCL2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q08045", "id": "Q08045" }, { "name": "LCL2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013205", "id": "NP_013205" } ], "protein_names": [ { "name": "Long chronological lifespan protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q08045" }, { "name": "Lcl2p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013205", "id": "NP_013205" } ], "function": [ { "annotation": "Probable component of the endoplasmic reticulum-associated degradation (ERAD) pathway that acts upstream of HRD3 and USA1.", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045#function" }, { "database": "PubMed", "id": "19325107", "url": "https://glygen.org/publication/PubMed/19325107" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "common_name": "Yeast" } ], "gene": [ { "name": "LCL2", "url": "https://www.uniprot.org/uniprot/Q08045", "locus": {} } ], "crossref": [ { "id": "850794", "url": "https://www.ncbi.nlm.nih.gov/gene/850794", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR034543", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034543", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR104W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR104W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KPATHDE", "url": "https://omabrowser.org/oma/group/KPATHDE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1431023at2759", "url": "http://www.orthodb.org/?query=1431023at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR38425", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR38425", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR38425:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR38425:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q08045", "url": "http://purl.obolibrary.org/obo/PR_Q08045", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013205", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004094", "url": "https://www.yeastgenome.org/locus/S000004094", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q08045-1", "url": "https://www.uniprot.org/uniprot/Q08045-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQSRWSIVLIFALFIFGSTGVNAFFNFGHHQQQQQQQQQSYEDQVLNNPCDGYLCPDTLTCVAQQKDCPCPFPKSQLKCVLPDNKFVCISKPATHNEKFRAIYDDPVKGPKAKNKGFRDCGWVSDAYKNH", "length": 131, "header": "sp|Q08045-1|LCL2_YEAST Isoform 1 of Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LCL2 PE=1 SV=1 CANONICAL=Q08045-1" }, "isoforms": [ { "isoform_ac": "Q08045-1", "url": "", "sequence": { "sequence": "MSQSRWSIVLIFALFIFGSTGVNAFFNFGHHQQQQQQQQQSYEDQVLNNPCDGYLCPDTLTCVAQQKDCPCPFPKSQLKCVLPDNKFVCISKPATHNEKFRAIYDDPVKGPKAKNKGFRDCGWVSDAYKNH", "length": 131, "header": "sp|Q08045-1|LCL2_YEAST Isoform 1 of Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LCL2 PE=1 SV=1 CANONICAL=Q08045-1" }, "locus": { "chromosome": "XII", "start_pos": 346977, "end_pos": 346585, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR104W_mRNA", "url": "https://www.ensembl.org/id/YLR104W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR104W", "url": "https://www.ensembl.org/id/YLR104W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum.", "journal": "Science", "date": "2009", "authors": "Schwappach B., Oh E., Schuldiner M., Walter P., Weissman J.S., Collins S.R., Denic V., Schmid V., Jonikas M.C., Quan E.M., Weibezahn J.", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "reference": [ { "type": "PubMed", "id": "19325107", "url": "https://glygen.org/publication/PubMed/19325107" } ] }, { "title": "A microarray-based genetic screen for yeast chronological aging factors.", "journal": "PLoS Genet.", "date": "2010", "authors": "Boeke J.D., Smith D.L., Smith J.S., Pan X., Bekiranov S., Maqani N., Matecic M.", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "reference": [ { "type": "PubMed", "id": "20421943", "url": "https://glygen.org/publication/PubMed/20421943" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLR104W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR104W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "ubiquitin-dependent ERAD pathway", "id": "GO:0030433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030433", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "fungal-type vacuole", "id": "GO:0000324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000324", "evidence": [ { "database": "UniProtKB", "id": "Q08045", "url": "https://www.uniprot.org/uniprot/Q08045" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }