{ "uniprot_canonical_ac": "Q06688-1", "uniprot_ac": "Q06688", "uniprot_id": "SRR1L_YEAST", "mass": { "chemical_mass": 31707.0, "monoisotopic_mass": 31707.0 }, "refseq": { "ac": "NP_013516", "name": "Ber1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013516" }, "gene_names": [ { "name": "BER1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q06688", "id": "Q06688" }, { "name": "BER1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013516", "id": "NP_013516" }, { "name": "L9931.5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q06688", "id": "Q06688" } ], "protein_names": [ { "name": "SRR1-like protein BER1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q06688" }, { "name": "Benomyl resistant protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q06688" }, { "name": "Ber1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013516", "id": "NP_013516" } ], "function": [ { "annotation": "Involved in microtubule stability and kinetochore function. May be involved in protein N-terminus acetylation and/or proteasome biogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688#function" }, { "database": "PubMed", "id": "18064466", "url": "https://glygen.org/publication/PubMed/18064466" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "common_name": "Yeast" } ], "gene": [ { "name": "BER1", "url": "https://www.uniprot.org/uniprot/Q06688", "locus": {} } ], "crossref": [ { "id": "851130", "url": "https://www.ncbi.nlm.nih.gov/gene/851130", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR012942", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012942", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR412W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR412W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "THIRCLA", "url": "https://omabrowser.org/oma/group/THIRCLA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2035768at2759", "url": "http://www.orthodb.org/?query=2035768at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28626", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28626", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28626:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28626:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07985", "url": "http://pfam.xfam.org/family/PF07985", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q06688", "url": "http://purl.obolibrary.org/obo/PR_Q06688", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013516", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013516", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004404", "url": "https://www.yeastgenome.org/locus/S000004404", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q06688-1", "url": "https://www.uniprot.org/uniprot/Q06688-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDFKASGTKFKKTGKKVVPAKAFEEIVQTNRDVLKKSAFLSDLLENLQPHLNNIKKIRCVAIGNFKEDFPATYQFALLLEITDYIKSEDERDVVVSLYDPIFTKEEIQYLKSLGSKWLIEEEFSENDAIDYESVLYFLPHAPLDLTENILSSQRPHLWLANNMISHTDRYTKAKLCENYPNLSKLVHYLQTNAPPEVKKAHDVDGFATFIPKRKRKNRNNSSKLKVTPSDIDYDSIAPKFKSCQILTDFDEGKYLKEKPWINSFSDLTLHAIEY", "length": 274, "header": "sp|Q06688-1|SRR1L_YEAST Isoform 1 of SRR1-like protein BER1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=BER1 PE=1 SV=1 CANONICAL=Q06688-1" }, "isoforms": [ { "isoform_ac": "Q06688-1", "url": "", "sequence": { "sequence": "MDFKASGTKFKKTGKKVVPAKAFEEIVQTNRDVLKKSAFLSDLLENLQPHLNNIKKIRCVAIGNFKEDFPATYQFALLLEITDYIKSEDERDVVVSLYDPIFTKEEIQYLKSLGSKWLIEEEFSENDAIDYESVLYFLPHAPLDLTENILSSQRPHLWLANNMISHTDRYTKAKLCENYPNLSKLVHYLQTNAPPEVKKAHDVDGFATFIPKRKRKNRNNSSKLKVTPSDIDYDSIAPKFKSCQILTDFDEGKYLKEKPWINSFSDLTLHAIEY", "length": 274, "header": "sp|Q06688-1|SRR1L_YEAST Isoform 1 of SRR1-like protein BER1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=BER1 PE=1 SV=1 CANONICAL=Q06688-1" }, "locus": { "chromosome": "XII", "start_pos": 949189, "end_pos": 948368, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR412W_mRNA", "url": "https://www.ensembl.org/id/YLR412W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR412W", "url": "https://www.ensembl.org/id/YLR412W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "Q06688", "url": "https://www.yeastgenome.org/locus/Q06688" }, { "database": "iPTMnet", "id": "Q06688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06688" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr227" }, { "start_pos": 229, "end_pos": 229, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q06688", "url": "https://www.yeastgenome.org/locus/Q06688" }, { "database": "iPTMnet", "id": "Q06688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06688" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser229" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The evolutionary conserved BER1 gene is involved in microtubule stability in yeast.", "journal": "Curr. Genet.", "date": "2008", "authors": "Cameroni E., Cerutti L., Fankhauser C., Barral Y., De Virgilio C., Fiechter V.", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "reference": [ { "type": "PubMed", "id": "18064466", "url": "https://glygen.org/publication/PubMed/18064466" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "Q06688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06688" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLR412W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR412W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "pmid": "" }, { "name": "microtubule", "id": "GO:0005874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005874", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "microtubule-based process", "id": "GO:0007017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007017", "evidence": [ { "database": "UniProtKB", "id": "Q06688", "url": "https://www.uniprot.org/uniprot/Q06688" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 181, "end_pos": 183, "annotation": "n_glycosylation_sequon" }, { "start_pos": 219, "end_pos": 221, "annotation": "n_glycosylation_sequon" }, { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }