{ "uniprot_canonical_ac": "Q06107-1", "uniprot_ac": "Q06107", "uniprot_id": "YP114_YEAST", "mass": { "chemical_mass": 36750.0, "monoisotopic_mass": 36750.0 }, "refseq": { "ac": "NP_015439", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015439" }, "gene_names": [], "protein_names": [ { "name": "Uncharacterized TLC domain-containing protein YPR114W", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q06107" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015439", "id": "NP_015439" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q06107", "locus": {} } ], "crossref": [ { "id": "856230", "url": "https://www.ncbi.nlm.nih.gov/gene/856230", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q06107", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q06107*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006634", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006634", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YPR114W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR114W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "AIGYFLW", "url": "https://omabrowser.org/oma/group/AIGYFLW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "296740at2759", "url": "http://www.orthodb.org/?query=296740at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13439", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13439", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13439:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13439:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03798", "url": "http://pfam.xfam.org/family/PF03798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q06107", "url": "http://purl.obolibrary.org/obo/PR_Q06107", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_015439", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_015439", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000006318", "url": "https://www.yeastgenome.org/locus/S000006318", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q06107-1", "url": "https://www.uniprot.org/uniprot/Q06107-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDVLLSLPQPELFKTTVIPFLANRNIIKSEAILSNLHSIFYVAIFYHIWFLFGKWILFPHLVKWKLDYDQKHNVKKDEKTTSERQAQHYKKKYTSLINQSSVHLISLLQSIVVLYYSLKFLLDPKASAEPYQTSHSRVFTENRDTQVICIFAIGYFVWDIYISTMYSTFPFVVHGIISTVVFCIGLKPYIQYYAPVFLMFELSNPSLNFRWFGIKFLPQKSKFCSLLLLLNNLTLMVVFFAARIAWGWFQIGKLCYDFYQVRNEPGFLVFDTIVILAGNFVLDILNVIWFSTMVSVAAKVLKKGESVDKVTKNEQ", "length": 315, "header": "sp|Q06107-1|YP114_YEAST Isoform 1 of Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q06107-1" }, "isoforms": [ { "isoform_ac": "Q06107-1", "url": "", "sequence": { "sequence": "MDVLLSLPQPELFKTTVIPFLANRNIIKSEAILSNLHSIFYVAIFYHIWFLFGKWILFPHLVKWKLDYDQKHNVKKDEKTTSERQAQHYKKKYTSLINQSSVHLISLLQSIVVLYYSLKFLLDPKASAEPYQTSHSRVFTENRDTQVICIFAIGYFVWDIYISTMYSTFPFVVHGIISTVVFCIGLKPYIQYYAPVFLMFELSNPSLNFRWFGIKFLPQKSKFCSLLLLLNNLTLMVVFFAARIAWGWFQIGKLCYDFYQVRNEPGFLVFDTIVILAGNFVLDILNVIWFSTMVSVAAKVLKKGESVDKVTKNEQ", "length": 315, "header": "sp|Q06107-1|YP114_YEAST Isoform 1 of Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q06107-1" }, "locus": { "chromosome": "XVI", "start_pos": 754245, "end_pos": 753301, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YPR114W_mRNA", "url": "https://www.ensembl.org/id/YPR114W_mRNA" }, { "database": "Ensembl Peptide", "id": "YPR114W", "url": "https://www.ensembl.org/id/YPR114W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A global topology map of the Saccharomyces cerevisiae membrane proteome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Kim H., von Heijne G., Melen K., Oesterberg M.", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "16847258", "url": "https://glygen.org/publication/PubMed/16847258" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "reference": [ { "type": "PubMed", "id": "9169875", "url": "https://glygen.org/publication/PubMed/9169875" } ] } ], "pathway": [ { "id": "sce:YPR114W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR114W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid homeostasis", "id": "GO:0055088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055088", "evidence": [ { "database": "UniProtKB", "id": "Q06107", "url": "https://www.uniprot.org/uniprot/Q06107" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 232, "end_pos": 234, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }