{
    "uniprot_canonical_ac": "Q05924-1",
    "uniprot_ac": "Q05924",
    "uniprot_id": "DCR2_YEAST",
    "mass": {
        "chemical_mass": 66463.0,
        "monoisotopic_mass": 66463.0
    },
    "refseq": {
        "ac": "NP_013465",
        "name": "phosphoprotein phosphatase",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013465"
    },
    "gene_names": [
        {
            "name": "DCR2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q05924",
            "id": "Q05924"
        },
        {
            "name": "DCR2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013465",
            "id": "NP_013465"
        }
    ],
    "protein_names": [
        {
            "name": "Phosphatase DCR2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q05924"
        },
        {
            "name": "3.1.-.-",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q05924"
        },
        {
            "name": "Dosage-dependent cell cycle regulator 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q05924"
        },
        {
            "name": "phosphoprotein phosphatase",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013465",
            "id": "NP_013465"
        }
    ],
    "function": [
        {
            "annotation": "Required for cell cycle progression. Has a role in the completion of START.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924#function"
                },
                {
                    "database": "PubMed",
                    "id": "15590836",
                    "url": "https://glygen.org/publication/PubMed/15590836"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [
        {
            "start_pos": 338,
            "end_pos": 338,
            "sequence_org": "H",
            "sequence_mut": "A",
            "comment": "20% phosphatase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                },
                {
                    "database": "PubMed",
                    "id": "15590836",
                    "url": "https://glygen.org/publication/PubMed/15590836"
                }
            ]
        }
    ],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Saccharomyces cerevisiae S288C",
            "taxid": 559292,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                }
            ],
            "common_name": "Yeast"
        }
    ],
    "gene": [
        {
            "name": "DCR2",
            "url": "https://www.uniprot.org/uniprot/Q05924",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "cd07383",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07383",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "851075",
            "url": "https://www.ncbi.nlm.nih.gov/gene/851075",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q05924",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q05924*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR004843",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR004843",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR029052",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029052",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "sce:YLR361C",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR361C",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "CEADPKT",
            "url": "https://omabrowser.org/oma/group/CEADPKT/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1407670at2759",
            "url": "http://www.orthodb.org/?query=1407670at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR32440",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32440",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR32440:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32440:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00149",
            "url": "http://pfam.xfam.org/family/PF00149",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q05924",
            "url": "http://purl.obolibrary.org/obo/PR_Q05924",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_013465",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013465",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "S000004353",
            "url": "https://www.yeastgenome.org/locus/S000004353",
            "database": "SGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q05924",
            "url": "https://www.uniprot.org/uniprot/Q05924",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q05924-1",
            "url": "https://www.uniprot.org/uniprot/Q05924-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MIRLPRLYQRYLLYLVVFVVIALFYFLQAPRVEEHIGFDLALPISHVDNLWFQNKGLEGFSNDDKLVVNIGYDECFHIGRFYEGCFNRHELKSTLTDGHQYLQRKRIHKDLRGSFGRRWFGKSEYLYYDVLYPALVDYFGSNLEKLNVEAVTGISKYPKDKSLPFMDVSITFEPISIELLQKRSYISDINILFGVDCIQPIANWTLQKEFPLVKYRYSEPAYLTYKFVGTRPVDTGAQRLQETDEGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFSPHDTHDNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAPKYNSEGITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQSMLDGNSPESV",
        "length": 578,
        "header": "sp|Q05924-1|DCR2_YEAST Isoform 1 of Phosphatase DCR2  OS=Saccharomyces cerevisiae S288C OX=559292 GN=DCR2 PE=1 SV=1 CANONICAL=Q05924-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q05924-1",
            "url": "",
            "sequence": {
                "sequence": "MIRLPRLYQRYLLYLVVFVVIALFYFLQAPRVEEHIGFDLALPISHVDNLWFQNKGLEGFSNDDKLVVNIGYDECFHIGRFYEGCFNRHELKSTLTDGHQYLQRKRIHKDLRGSFGRRWFGKSEYLYYDVLYPALVDYFGSNLEKLNVEAVTGISKYPKDKSLPFMDVSITFEPISIELLQKRSYISDINILFGVDCIQPIANWTLQKEFPLVKYRYSEPAYLTYKFVGTRPVDTGAQRLQETDEGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFSPHDTHDNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAPKYNSEGITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQSMLDGNSPESV",
                "length": 578,
                "header": "sp|Q05924-1|DCR2_YEAST Isoform 1 of Phosphatase DCR2  OS=Saccharomyces cerevisiae S288C OX=559292 GN=DCR2 PE=1 SV=1 CANONICAL=Q05924-1"
            },
            "locus": {
                "chromosome": "XII",
                "start_pos": 849124,
                "end_pos": 847391,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "YLR361C_mRNA",
                        "url": "https://www.ensembl.org/id/YLR361C_mRNA"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "YLR361C",
                        "url": "https://www.ensembl.org/id/YLR361C"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "Global analysis of protein expression in yeast.",
            "journal": "Nature",
            "date": "2003",
            "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14562106",
                    "url": "https://glygen.org/publication/PubMed/14562106"
                }
            ]
        },
        {
            "title": "Gid8p (Dcr1p) and Dcr2p function in a common pathway to promote START completion in Saccharomyces cerevisiae.",
            "journal": "Eukaryot. Cell",
            "date": "2004",
            "authors": "Pathak Ritu, Bogomolnaya Lydia M, Guo Jinbai, Polymenis Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15590836",
                    "url": "https://glygen.org/publication/PubMed/15590836"
                }
            ]
        },
        {
            "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.",
            "journal": "G3 (Bethesda)",
            "date": "2014",
            "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24374639",
                    "url": "https://glygen.org/publication/PubMed/24374639"
                }
            ]
        },
        {
            "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q05924",
                    "url": "https://www.uniprot.org/uniprot/Q05924"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9169871",
                    "url": "https://glygen.org/publication/PubMed/9169871"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "sce:YLR361C",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR361C",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "negative regulation of endoplasmic reticulum unfolded protein response",
                        "id": "GO:1900102",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900102",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell cycle",
                        "id": "GO:0007049",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "traversing start control point of mitotic cell cycle",
                        "id": "GO:0007089",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007089",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hydrolase activity, acting on ester bonds",
                        "id": "GO:0016788",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016788",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "phosphoprotein phosphatase activity",
                        "id": "GO:0004721",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004721",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "fungal-type vacuole",
                        "id": "GO:0000324",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000324",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q05924",
                                "url": "https://www.uniprot.org/uniprot/Q05924"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 203,
            "end_pos": 205,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 386,
            "end_pos": 388,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 557,
            "end_pos": 559,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}