{ "uniprot_canonical_ac": "Q05567-1", "uniprot_ac": "Q05567", "uniprot_id": "SGPL_YEAST", "mass": { "chemical_mass": 65566.0, "monoisotopic_mass": 65566.0 }, "refseq": { "ac": "NP_010580", "name": "sphinganine-1-phosphate aldolase DPL1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010580" }, "gene_names": [ { "name": "DPL1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q05567", "id": "Q05567" }, { "name": "BST1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010580", "id": "NP_010580" }, { "name": "BST1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q05567", "id": "Q05567" }, { "name": "D9819.5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q05567", "id": "Q05567" }, { "name": "DPL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010580", "id": "NP_010580" } ], "protein_names": [ { "name": "Sphingosine-1-phosphate lyase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q05567" }, { "name": "4.1.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "4.1.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "Bestowed of sphingosine tolerance 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "S1PL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "SP-lyase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "Sphingosine-1-phosphate aldolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" }, { "name": "sphinganine-1-phosphate aldolase DPL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010580", "id": "NP_010580" }, { "name": "ySPL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05567" } ], "function": [ { "annotation": "Sphingosine-1-phosphate lyase that cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine (PubMed:20696404, PubMed:25345524, PubMed:9334171). Prefers C-16 dihydrosphingosine-l-phosphate (DHS-P) as a substrate. Regulates intracellular levels of sphingolipid long-chain base phosphates (LCBPs) (PubMed:11795842). Plays a role in the regulation of global responses to nutrient deprivation in yeast (PubMed:10329480).", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567#function" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" }, { "database": "PubMed", "id": "25345524", "url": "https://glygen.org/publication/PubMed/25345524" }, { "database": "PubMed", "id": "11795842", "url": "https://glygen.org/publication/PubMed/11795842" }, { "database": "PubMed", "id": "9334171", "url": "https://glygen.org/publication/PubMed/9334171" }, { "database": "PubMed", "id": "10329480", "url": "https://glygen.org/publication/PubMed/10329480" } ] } ], "disease": [ { "disease_id": "DOID:0080265", "recommended_name": { "id": "DOID:0080265", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080265", "name": "nephrotic syndrome type 14", "description": "A familial nephrotic syndrome that has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the sphingosine-1-phosphate lyase 1 (SGPL1) gene on chromosome 10q21." }, "synonyms": [ { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "nephrotic syndrome, type 14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "primary adrenal insufficiency-steroid-resistant nephrotic syndrome due to SGPL1 deficiency", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "NPHS14", "description": "" }, { "id": "MONDO:0033203", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033203", "name": "familial steroid-resistant nephrotic syndrome with adrenal insufficiency", "description": "" }, { "id": "MIM:617575", "resource": "MIM", "url": "https://www.omim.org/entry/617575", "name": "Nephrotic syndrome 14", "description": "Nephrotic syndrome 14" } ], "evidence": [ { "id": "0080265", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080265" } ] }, { "disease_id": "DOID:10595", "recommended_name": { "id": "DOID:10595", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10595", "name": "Charcot-Marie-Tooth disease", "description": "A neuromuscular disease that is characterized by a slowly progressive degeneration of the muscles of the foot, lower leg, hand and forearm." }, "synonyms": [ { "id": "DOID:10595", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10595", "name": "CMT - Charcot-Marie-Tooth disease", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease type 1A", "description": "Charcot-Marie-Tooth disease type 1A (CMT1A) is a type ofinherited neurological disorder that affects the peripheral nerves. Affected individuals experience weakness and wasting (atrophy) of the muscles of the lower legs beginning in adolescence; later they experience hand weakness and sensory loss. CMT1A is caused byhaving an extra copy (a duplication) of the PMP22 gene. It is inherited in an autosomal dominant manner. Treatment for this condition may include physical therapy ; occupational therapy ; braces and other orthopedic devices; orthopedic surgery;and pain medications." }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "CMT1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth neuropathy type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth syndrome type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "HMSN1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "autosomal dominant Charcot-Marie-Tooth disease with focally folded myelin sheaths type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "hereditary motor and sensory neuropathy 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "microduplication 17p12", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "CMT 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot Marie Tooth disease type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, autosomal dominant, with focally folded myelin sheaths, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth disease, demyelinating, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "Charcot-Marie-Tooth neuropathy, type 1A", "description": "" }, { "id": "MONDO:0007309", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007309", "name": "HMSN 1A", "description": "" }, { "id": "MIM:118220", "resource": "MIM", "url": "https://www.omim.org/entry/118220", "name": "Charcot-Marie-Tooth disease, demyelinating, 1A", "description": "Charcot-Marie-Tooth disease, demyelinating, 1A" } ], "evidence": [ { "id": "10595", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10595" } ] }, { "disease_id": "DOID:1184", "recommended_name": { "id": "DOID:1184", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1184", "name": "nephrotic syndrome", "description": "A nephrosis characterized by marked increase in glomerular protein permeability resulting in marked elevation of urine protein levels, hypoalbuminemia, hyperlipidemia, and hypercoagulability." }, "synonyms": [], "evidence": [ { "id": "1184", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1184" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 172, "end_pos": 172, "sequence_org": "A", "sequence_mut": "P", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 174, "end_pos": 174, "sequence_org": "Y", "sequence_mut": "F", "comment": "Mildly decreased enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 198, "end_pos": 198, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 380, "end_pos": 380, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 386, "end_pos": 386, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 554, "end_pos": 554, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decreased enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "start_pos": 65, "end_pos": 71, "sequence_org": "CYKLISN", "sequence_mut": "LYLLILL", "comment": "In Dpl1CKSN_LLLL; impairs the formation of higher oder oligomeric complexes and consequently reduces catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "18487605", "url": "https://glygen.org/publication/PubMed/18487605" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "K", "sequence_mut": "L", "comment": "Reduces catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "18487605", "url": "https://glygen.org/publication/PubMed/18487605" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "common_name": "Yeast" } ], "gene": [ { "name": "DPL1", "url": "https://www.uniprot.org/uniprot/Q05567", "locus": { "chromosome": "IV", "start_pos": 1050459, "end_pos": 1052228, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YDR294C", "url": "https://www.ensembl.org/id/YDR294C" } ] } } ], "crossref": [ { "id": "4.1.2.27", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.1.2.27&UniProtAcc=Q05567", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd06450", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06450", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "851888", "url": "https://www.ncbi.nlm.nih.gov/gene/851888", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q05567", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q05567*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002129", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015421", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015421", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR294C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR294C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FKDHQFT", "url": "https://omabrowser.org/oma/group/FKDHQFT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3024111at2759", "url": "http://www.orthodb.org/?query=3024111at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR42735:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42735:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3MC6", "url": "https://www.rcsb.org/structure/3MC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00282", "url": "http://pfam.xfam.org/family/PF00282", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q05567", "url": "http://purl.obolibrary.org/obo/PR_Q05567", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010580", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010580", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002702", "url": "https://www.yeastgenome.org/locus/S000002702", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05567-1", "url": "https://www.uniprot.org/uniprot/Q05567-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGVSNKTVSINGWYGMPIHLLREEGDFAQFMILTINELKIAIHGYLRNTPWYNMLKDYLFVIFCYKLISNFFYLLKVYGPVRLAVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTILLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLNIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATK", "length": 589, "header": "sp|Q05567-1|SGPL_YEAST Isoform 1 of Sphingosine-1-phosphate lyase OS=Saccharomyces cerevisiae S288C OX=559292 GN=DPL1 PE=1 SV=1 CANONICAL=Q05567-1" }, "isoforms": [ { "isoform_ac": "Q05567-1", "url": "", "sequence": { "sequence": "MSGVSNKTVSINGWYGMPIHLLREEGDFAQFMILTINELKIAIHGYLRNTPWYNMLKDYLFVIFCYKLISNFFYLLKVYGPVRLAVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTILLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLNIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATK", "length": 589, "header": "sp|Q05567-1|SGPL_YEAST Isoform 1 of Sphingosine-1-phosphate lyase OS=Saccharomyces cerevisiae S288C OX=559292 GN=DPL1 PE=1 SV=1 CANONICAL=Q05567-1" }, "locus": { "chromosome": "IV", "start_pos": 1052228, "end_pos": 1050462, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR294C_mRNA", "url": "https://www.ensembl.org/id/YDR294C_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR294C", "url": "https://www.ensembl.org/id/YDR294C" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 6, "start_aa": "Asn", "end_pos": 6, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn6", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] } ], "phosphorylation": [ { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05567", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05567" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Thr162" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "The DPL1 gene is involved in mediating the response to nutrient deprivation in Saccharomyces cerevisiae.", "journal": "Mol. Cell Biol. Res. Commun.", "date": "1999", "authors": "Saba J.D., Gottlieb D., Heideman W.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "10329480", "url": "https://glygen.org/publication/PubMed/10329480" } ] }, { "title": "Elevation of endogenous sphingolipid long-chain base phosphates kills Saccharomyces cerevisiae cells.", "journal": "Curr. Genet.", "date": "2001", "authors": "Zhang X., Dickson R.C., Lester R.L., Skrzypek M.S.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "11795842", "url": "https://glygen.org/publication/PubMed/11795842" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Identifying key residues of sphinganine-1-phosphate lyase for function in vivo and in vitro.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Mukhopadhyay Debdyuti, Howell Kate S, Riezman Howard, Capitani Guido", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "18487605", "url": "https://glygen.org/publication/PubMed/18487605" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "Q05567", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05567" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "Q05567", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05567" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "Structure and function of sphingosine-1-phosphate lyase, a key enzyme of sphingolipid metabolism.", "journal": "Structure", "date": "2010", "authors": "Bourquin F, Riezman H, Capitani G, Grutter MG", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "20696404", "url": "https://glygen.org/publication/PubMed/20696404" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Identification of the phytosphingosine metabolic pathway leading to odd-numbered fatty acids.", "journal": "Nat. Commun.", "date": "2014", "authors": "Kondo N., Seki N., Kihara A., Kitamura T., Naganuma T., Ohno Y., Obara T., Yamagata M.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "25345524", "url": "https://glygen.org/publication/PubMed/25345524" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] }, { "title": "The BST1 gene of Saccharomyces cerevisiae is the sphingosine-1-phosphate lyase.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Bielawska A., Hannun Y.A., Garrett S., Saba J.D., Nara F.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "9334171", "url": "https://glygen.org/publication/PubMed/9334171" } ] }, { "title": "Identification of the first mammalian sphingosine phosphate lyase gene and its functional expression in yeast.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Zhou J., Saba J.D.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "reference": [ { "type": "PubMed", "id": "9464245", "url": "https://glygen.org/publication/PubMed/9464245" } ] } ], "pathway": [ { "id": "sce:YDR294C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR294C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O95470-1", "protein_name": "Sphingosine-1-phosphate lyase 1", "gene_name": "SGPL1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH", "length": 568 }, "evidence": [ { "id": "Q05567", "url": "https://omabrowser.org/oma/group/Q05567/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R0X7-1", "protein_name": "Sphingosine-1-phosphate lyase 1", "gene_name": "Sgpl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAWSVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMPFLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQAYGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTAMLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR", "length": 568 }, "evidence": [ { "id": "Q05567", "url": "https://omabrowser.org/oma/group/Q05567/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9V7Y2-1", "protein_name": "Sphingosine-1-phosphate lyase", "gene_name": "Sply", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MRPFSGSDCLKPVTEGINRAFGAKEPWQVATITATTVLGGVWLWTVICQDENLYIRGKRQFFKFAKKIPAVRRQVETELAKAKNDFETEIKKSNAHLTYSETLPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPDLVELVTEVYGKASYTNPLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIVMAMKAYRDFAREYKGITRPNIVVPKTVHAAFDKGGQYFNIHVRSVDVDPETYEVDIKKFKRAINRNTILLVGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEVKGVTSISADTHKYGFAPKGSSVILYSDKKYKDHQFTVTTDWPGGVYGSPTVNGSRAGGIIAACWATMMSFGYDGYLEATKRIVDTARYIERGVRDIDGIFIFGKPATSVIALGSNVFDIFRLSDSLCKLGWNLNALQFPSGIHLCVTDMHTQPGVADKFIADVRSCTAEIMKDPGQPVVGKMALYGMAQSIPDRSVIGEVTRLFLHSMYYTPSQK", "length": 545 }, "evidence": [ { "id": "Q05567", "url": "https://omabrowser.org/oma/group/Q05567/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "sphingolipid catabolic process", "id": "GO:0030149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030149", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "calcium-mediated signaling", "id": "GO:0019722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "sphingolipid metabolic process", "id": "GO:0006665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006665", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "carboxylic acid metabolic process", "id": "GO:0019752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019752", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "perinuclear endoplasmic reticulum", "id": "GO:0097038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097038", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "cortical endoplasmic reticulum", "id": "GO:0032541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032541", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "pyridoxal phosphate binding", "id": "GO:0030170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030170", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" }, { "name": "sphinganine-1-phosphate aldolase activity", "id": "GO:0008117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008117", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 6, "end_pos": 8, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q05567", "url": "https://www.uniprot.org/uniprot/Q05567" }, { "database": "PubMed", "id": "18487605", "url": "https://glygen.org/publication/PubMed/18487605" } ] } ], "interactions": [], "reactions": [ { "id": "18593", "name": "", "equation": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CHN6-1", "O95470-1", "Q8R0X7-1", "Q05567-1", "Q54RV9-1", "Q9V7Y2-1" ], "evidence": [ { "id": "18593", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18593" } ] }, { "id": "55208", "name": "", "equation": "(4R)-hydroxysphinganine 1-phosphate = (2R)-hydroxyhexadecanal + phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q05567-1" ], "evidence": [ { "id": "55208", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55208" } ] }, { "id": "R-SCE-428676", "name": "sphingosine 1-phosphate => phosphoethanolamine + hexadec-2-enal", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-428671" ], "enzyme_list": [ "Q05567-1" ], "evidence": [ { "id": "R-SCE-428676", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-428676" } ] }, { "id": "R-SCE-428681", "name": "sphinganine 1-phosphate => phosphoethanolamine + hexadecanal", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-428663" ], "enzyme_list": [ "Q05567-1" ], "evidence": [ { "id": "R-SCE-428681", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-428681" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-428663", "participant_name": "HXAL [cytosol]", "crossref": [ { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" }, { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" }, { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" }, { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "17600", "database": "ChEBI", "url": "" }, { "id": "6627", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001551", "database": "HMDB Metabolite", "url": "" }, { "id": "C00517", "database": "COMPOUND", "url": "" }, { "id": "000008216082", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-428671", "participant_name": "HD2NAL [cytosol]", "crossref": [ { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" }, { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" }, { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" }, { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" }, { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "17585", "database": "ChEBI", "url": "" }, { "id": "000008217876", "database": "ZINC", "url": "" }, { "id": "HMDB0060482", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O95470", "gene_name": "SGPL1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "O95470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95470" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "O95470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95470" } ] } ] }, { "uniprot_ac": "Q05567", "gene_name": "DPL1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] }, { "ec_number": "4.1.2.-", "activity": "", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q05567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05567" } ] } ] }, { "uniprot_ac": "Q54RV9", "gene_name": "sglA", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q54RV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV9" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q54RV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RV9" } ] } ] }, { "uniprot_ac": "Q8CHN6", "gene_name": "Sgpl1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q8CHN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHN6" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q8CHN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHN6" } ] } ] }, { "uniprot_ac": "Q8R0X7", "gene_name": "Sgpl1", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q8R0X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0X7" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q8R0X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R0X7" } ] } ] }, { "uniprot_ac": "Q9V7Y2", "gene_name": "Sply", "activity": [ { "ec_number": "4.1.2.27", "activity": "sphinganine 1-phosphate = hexadecanal + phosphoethanolamine.", "evidence": [ { "id": "Q9V7Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V7Y2" } ] }, { "ec_number": "4.1.2.27", "activity": "", "evidence": [ { "id": "Q9V7Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V7Y2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }