{ "uniprot_canonical_ac": "Q05095-1", "uniprot_ac": "Q05095", "uniprot_id": "CDX1_RAT", "mass": { "chemical_mass": 14300.0, "monoisotopic_mass": 14300.0 }, "refseq": {}, "gene_names": [ { "name": "Cdx1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q05095", "id": "Q05095" }, { "name": "Cdx-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q05095", "id": "Q05095" } ], "protein_names": [ { "name": "Homeobox protein CDX-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q05095" }, { "name": "Caudal-type homeobox protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q05095" } ], "function": [ { "annotation": "Plays a role in transcriptional regulation. Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells. Binds to the PRKD1 promoter in colorectal cancer (CRC) cells. Could play a role in the terminal differentiation of the intestine. Binds preferentially to methylated DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095#function" }, { "database": "UniProtKB", "id": "P47902", "url": "https://www.uniprot.org/uniprot/P47902#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cdx1", "url": "https://www.uniprot.org/uniprot/Q05095", "locus": { "chromosome": "18", "start_pos": 54473444, "end_pos": 54490814, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000060334", "url": "https://www.ensembl.org/id/ENSRNOG00000060334" } ] } } ], "crossref": [ { "id": "ENSRNOG00000060334", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000060334", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006820", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006820", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "VDKDTNM", "url": "https://omabrowser.org/oma/group/VDKDTNM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24332", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24332", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24332:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24332:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04731", "url": "http://pfam.xfam.org/family/PF04731", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "621233", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621233", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K086", "url": "https://www.uniprot.org/uniprot/A0A0G2K086", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K086-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K086-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05095-1", "url": "https://www.uniprot.org/uniprot/Q05095-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "KTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQQQQQQPMPPTQLPLPLDGTPTPSGHPGSLCPTNAGLLGTPSPVPVKEEFLP", "length": 123, "header": "sp|Q05095-1|CDX1_RAT Isoform 1 of Homeobox protein CDX-1 OS=Rattus norvegicus OX=10116 GN=Cdx1 PE=2 SV=1 CANONICAL=Q05095-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K086-1", "url": "", "sequence": { "sequence": "MYVGYVLDKDSPVYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDWAAAYGPGPAVPAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGGPGAPSSPGVQRRTPYEWMRRNVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQQQQQQPMPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP", "length": 273, "header": "tr|A0A0G2K086-1|A0A0G2K086_RAT Computationally mapped isoform of Caudal type homeo box 1 OS=Rattus norvegicus OX=10116 GN=Cdx1 PE=3 SV=2 CANONICAL=Q05095-1" }, "locus": { "chromosome": "18", "start_pos": 54490814, "end_pos": 54473447, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083379.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083379.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071345.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071345.2" } ] } }, { "isoform_ac": "Q05095-1", "url": "", "sequence": { "sequence": "KTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQQQQQQPMPPTQLPLPLDGTPTPSGHPGSLCPTNAGLLGTPSPVPVKEEFLP", "length": 123, "header": "sp|Q05095-1|CDX1_RAT Isoform 1 of Homeobox protein CDX-1 OS=Rattus norvegicus OX=10116 GN=Cdx1 PE=2 SV=1 CANONICAL=Q05095-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Gradient expression of Cdx along the rat intestine throughout postnatal development.", "journal": "FEBS Lett.", "date": "1992", "authors": "Freund J.-N., Benazzouz A., Boukamel R.", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "reference": [ { "type": "PubMed", "id": "1360907", "url": "https://glygen.org/publication/PubMed/1360907" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "methyl-CpG binding", "id": "GO:0008327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008327", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "anterior/posterior pattern specification", "id": "GO:0009952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "bone morphogenesis", "id": "GO:0060349", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060349", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "pattern specification process", "id": "GO:0007389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007389", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" }, { "name": "regulation of somitogenesis", "id": "GO:0014807", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014807", "evidence": [ { "database": "UniProtKB", "id": "Q05095", "url": "https://www.uniprot.org/uniprot/Q05095" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }