{ "uniprot_canonical_ac": "Q04969-1", "uniprot_ac": "Q04969", "uniprot_id": "SPC2_YEAST", "mass": { "chemical_mass": 20802.0, "monoisotopic_mass": 20802.0 }, "refseq": { "ac": "NP_013657", "name": "signal peptidase complex subunit SPC2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013657" }, "gene_names": [ { "name": "SPC2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q04969", "id": "Q04969" }, { "name": "SPC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013657", "id": "NP_013657" }, { "name": "SPY1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013657", "id": "NP_013657" }, { "name": "SPY1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q04969", "id": "Q04969" }, { "name": "YM9958.07", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q04969", "id": "Q04969" } ], "protein_names": [ { "name": "Signal peptidase complex subunit 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q04969" }, { "name": "Microsomal signal peptidase subunit 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04969" }, { "name": "signal peptidase complex subunit SPC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013657", "id": "NP_013657" } ], "function": [ { "annotation": "Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:8910564, PubMed:10921929). Enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site (PubMed:8910564, PubMed:10921929).", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969#function" }, { "database": "PubMed", "id": "8910564", "url": "https://glygen.org/publication/PubMed/8910564" }, { "database": "PubMed", "id": "10921929", "url": "https://glygen.org/publication/PubMed/10921929" } ] } ], "disease": [ { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SPC2", "url": "https://www.uniprot.org/uniprot/Q04969", "locus": { "chromosome": "XIII", "start_pos": 165326, "end_pos": 164790, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YML055W", "url": "https://www.ensembl.org/id/YML055W" } ] } } ], "crossref": [ { "id": "854949", "url": "https://www.ncbi.nlm.nih.gov/gene/854949", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q04969", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q04969*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009582", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009582", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YML055W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YML055W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FAWDYKL", "url": "https://omabrowser.org/oma/group/FAWDYKL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2034797at2759", "url": "http://www.orthodb.org/?query=2034797at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13085", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13085", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13085:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13085:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06703", "url": "http://pfam.xfam.org/family/PF06703", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q04969", "url": "http://purl.obolibrary.org/obo/PR_Q04969", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013657", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013657", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004519", "url": "https://www.yeastgenome.org/locus/S000004519", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q04969-1", "url": "https://www.uniprot.org/uniprot/Q04969-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSAKPINVYSIPELNQALDEALPSVFARLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGTKEEIYVKTKFEKNEPLYLVELVQKKKGENSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKNE", "length": 178, "header": "sp|Q04969-1|SPC2_YEAST Isoform 1 of Signal peptidase complex subunit 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SPC2 PE=1 SV=1 CANONICAL=Q04969-1" }, "isoforms": [ { "isoform_ac": "Q04969-1", "url": "", "sequence": { "sequence": "MSSAKPINVYSIPELNQALDEALPSVFARLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGTKEEIYVKTKFEKNEPLYLVELVQKKKGENSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKNE", "length": 178, "header": "sp|Q04969-1|SPC2_YEAST Isoform 1 of Signal peptidase complex subunit 2 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SPC2 PE=1 SV=1 CANONICAL=Q04969-1" }, "locus": { "chromosome": "XIII", "start_pos": 165323, "end_pos": 164790, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YML055W_mRNA", "url": "https://www.ensembl.org/id/YML055W_mRNA" }, { "database": "Ensembl Peptide", "id": "YML055W", "url": "https://www.ensembl.org/id/YML055W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Hartmann E., Antonin W., Meyer H.A.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "10921929", "url": "https://glygen.org/publication/PubMed/10921929" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A global topology map of the Saccharomyces cerevisiae membrane proteome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Kim H., von Heijne G., Melen K., Oesterberg M.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "16847258", "url": "https://glygen.org/publication/PubMed/16847258" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Structurally related Spc1p and Spc2p of yeast signal peptidase complex are functionally distinct.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Hartmann E., Mullins C., Fang H., Green N., Meyer H.A.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "8910564", "url": "https://glygen.org/publication/PubMed/8910564" } ] }, { "title": "The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Hartmann E., Meyer H.A.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "9148931", "url": "https://glygen.org/publication/PubMed/9148931" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Pearson D., Bowman S., Hunt S., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Badcock K., Chillingworth T., Churcher C.M., Dedman K., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Walsh S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "reference": [ { "type": "PubMed", "id": "9169872", "url": "https://glygen.org/publication/PubMed/9169872" } ] } ], "pathway": [ { "id": "sce:YML055W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YML055W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "pmid": "" }, { "name": "signal peptidase complex", "id": "GO:0005787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005787", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "protein targeting to ER", "id": "GO:0045047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045047", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "pmid": "" }, { "name": "signal peptide processing", "id": "GO:0006465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006465", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "pmid": "" }, { "name": "negative regulation of post-translational protein targeting to membrane, translocation", "id": "GO:0120236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120236", "evidence": [ { "database": "UniProtKB", "id": "Q04969", "url": "https://www.uniprot.org/uniprot/Q04969" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }