{ "uniprot_canonical_ac": "Q04964-1", "uniprot_ac": "Q04964", "uniprot_id": "SML1_YEAST", "mass": { "chemical_mass": 11834.0, "monoisotopic_mass": 11834.0 }, "refseq": { "ac": "NP_013653", "name": "ribonucleotide reductase inhibiting protein SML1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013653" }, "gene_names": [ { "name": "SML1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q04964", "id": "Q04964" }, { "name": "SML1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013653", "id": "NP_013653" }, { "name": "YM9958.04", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q04964", "id": "Q04964" } ], "protein_names": [ { "name": "Ribonucleotide reductase inhibitor protein SML1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q04964" }, { "name": "ribonucleotide reductase inhibiting protein SML1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013653", "id": "NP_013653" } ], "function": [ { "annotation": "Strong inhibitor of ribonucleotide reductase (RNR1) and is involved in regulating dNTP production.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964#function" }, { "database": "PubMed", "id": "20566477", "url": "https://glygen.org/publication/PubMed/20566477" }, { "database": "PubMed", "id": "10593972", "url": "https://glygen.org/publication/PubMed/10593972" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 56, "end_pos": 61, "sequence_org": "SASASS", "sequence_mut": "AAAAAA", "comment": "Increased stability following gamma-irradiation and loss of phosphorylation by DUN1. Causes lethality in rnr1-W688G strain which has a mutation in RNR1.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "PubMed", "id": "20566477", "url": "https://glygen.org/publication/PubMed/20566477" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SML1", "url": "https://www.uniprot.org/uniprot/Q04964", "locus": {} } ], "crossref": [ { "id": "854945", "url": "https://www.ncbi.nlm.nih.gov/gene/854945", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q04964", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q04964*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YML058W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YML058W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MWEESVE", "url": "https://omabrowser.org/oma/group/MWEESVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2026314at2759", "url": "http://www.orthodb.org/?query=2026314at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_Q04964", "url": "http://purl.obolibrary.org/obo/PR_Q04964", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013653", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013653", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004523", "url": "https://www.yeastgenome.org/locus/S000004523", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q04964-1", "url": "https://www.uniprot.org/uniprot/Q04964-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQNSQDYFYAQNRCQQQQAPSTLRTVTMAEFRRVPLPPMAEVPMLSTQNSMGSSASASASSLEMWEKDLEERLNSIDHDMNNNKFGSGELKSMFNQGKVEEMDF", "length": 104, "header": "sp|Q04964-1|SML1_YEAST Isoform 1 of Ribonucleotide reductase inhibitor protein SML1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SML1 PE=1 SV=1 CANONICAL=Q04964-1" }, "isoforms": [ { "isoform_ac": "Q04964-1", "url": "", "sequence": { "sequence": "MQNSQDYFYAQNRCQQQQAPSTLRTVTMAEFRRVPLPPMAEVPMLSTQNSMGSSASASASSLEMWEKDLEERLNSIDHDMNNNKFGSGELKSMFNQGKVEEMDF", "length": 104, "header": "sp|Q04964-1|SML1_YEAST Isoform 1 of Ribonucleotide reductase inhibitor protein SML1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SML1 PE=1 SV=1 CANONICAL=Q04964-1" }, "locus": { "chromosome": "XIII", "start_pos": 159694, "end_pos": 159383, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YML058W_mRNA", "url": "https://www.ensembl.org/id/YML058W_mRNA" }, { "database": "Ensembl Peptide", "id": "YML058W", "url": "https://www.ensembl.org/id/YML058W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DUN1", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" }, { "database": "PubMed", "id": "14684746", "url": "https://glygen.org/publication/PubMed/14684746" }, { "database": "SGD", "id": "Q04964", "url": "https://www.yeastgenome.org/locus/Q04964" }, { "database": "PubMed", "id": "18832349", "url": "https://glygen.org/publication/PubMed/18832349" } ], "site_lbl": "Ser56" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DUN1", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" }, { "database": "PubMed", "id": "14684746", "url": "https://glygen.org/publication/PubMed/14684746" }, { "database": "SGD", "id": "Q04964", "url": "https://www.yeastgenome.org/locus/Q04964" }, { "database": "PubMed", "id": "18832349", "url": "https://glygen.org/publication/PubMed/18832349" } ], "site_lbl": "Ser58" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DUN1", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" }, { "database": "PubMed", "id": "14684746", "url": "https://glygen.org/publication/PubMed/14684746" }, { "database": "SGD", "id": "Q04964", "url": "https://www.yeastgenome.org/locus/Q04964" }, { "database": "PubMed", "id": "18832349", "url": "https://glygen.org/publication/PubMed/18832349" } ], "site_lbl": "Ser60" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" }, { "database": "SGD", "id": "Q04964", "url": "https://www.yeastgenome.org/locus/Q04964" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser75" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Yeast Sml1, a protein inhibitor of ribonucleotide reductase.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Thelander L., Chabes A., Domkin V.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "10593972", "url": "https://glygen.org/publication/PubMed/10593972" } ] }, { "title": "The Dun1 checkpoint kinase phosphorylates and regulates the ribonucleotide reductase inhibitor Sml1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Zhao X., Rothstein R.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "11904430", "url": "https://glygen.org/publication/PubMed/11904430" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Identification of phosphorylation sites on the yeast ribonucleotide reductase inhibitor Sml1.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Uchiki Tomoaki, Dice Lezlee T, Hettich Robert L, Dealwis Chris", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" } ], "reference": [ { "type": "PubMed", "id": "14684746", "url": "https://glygen.org/publication/PubMed/14684746" } ] }, { "title": "Sml1p is a dimer in solution: characterization of denaturation and renaturation of recombinant Sml1p.", "journal": "Biochemistry", "date": "2004", "authors": "Dice L.T., Gupta V., Xu Y., Zhao X., Guo J.T., Dealwis C.G., Rothstein R., Racca J., Uchiki T., Hettich R., Peterson C.B.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "15222768", "url": "https://glygen.org/publication/PubMed/15222768" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The spindle positioning protein Kar9p interacts with the sumoylation machinery in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2008-12", "authors": "Meednu Nida, Hoops Harold, D'Silva Sonia, Pogorzala Leah, Wood Schuyler, Farkas David, Sorrentino Mark, Sia Elaine, Meluh Pam, Miller Rita K", "evidence": [ { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" } ], "reference": [ { "type": "PubMed", "id": "18832349", "url": "https://glygen.org/publication/PubMed/18832349" } ] }, { "title": "The ribonucleotide reductase inhibitor, Sml1, is sequentially phosphorylated, ubiquitylated and degraded in response to DNA damage.", "journal": "Nucleic Acids Res.", "date": "2010", "authors": "Andreson Bethany L, Gupta Amitabha, Georgieva Bilyana P, Rothstein Rodney", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "20566477", "url": "https://glygen.org/publication/PubMed/20566477" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "Q04964", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04964" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Pearson D., Bowman S., Hunt S., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Badcock K., Chillingworth T., Churcher C.M., Dedman K., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Walsh S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "reference": [ { "type": "PubMed", "id": "9169872", "url": "https://glygen.org/publication/PubMed/9169872" } ] } ], "pathway": [ { "id": "sce:YML058W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YML058W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" }, { "name": "mitochondrion organization", "id": "GO:0007005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007005", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" }, { "name": "negative regulation of DNA replication", "id": "GO:0008156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008156", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" }, { "name": "regulation of ribonucleoside-diphosphate reductase activity", "id": "GO:1905117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905117", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ribonucleoside-diphosphate reductase inhibitor activity", "id": "GO:1990846", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990846", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated by DUN1, a downstream effector of the Mec1/Rad53 checkpoint pathway, in response to DNA damage. This promotes ubiquitination of SML1 and targets it for degradation by the 26S proteasome.", "evidence": [ { "database": "UniProtKB", "id": "Q04964", "url": "https://www.uniprot.org/uniprot/Q04964" }, { "database": "PubMed", "id": "20566477", "url": "https://glygen.org/publication/PubMed/20566477" }, { "database": "PubMed", "id": "14684746", "url": "https://glygen.org/publication/PubMed/14684746" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }