{ "uniprot_canonical_ac": "Q04841-1", "uniprot_ac": "Q04841", "uniprot_id": "3MG_MOUSE", "mass": { "chemical_mass": 36472.0, "monoisotopic_mass": 36472.0 }, "refseq": { "ac": "NP_034952", "name": "DNA-3-methyladenine glycosylase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952" }, "gene_names": [ { "name": "Mpg", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q04841", "id": "Q04841" }, { "name": "9830006D05; Aag; APNG; Mid1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952", "id": "NP_034952" }, { "name": "Mid1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q04841", "id": "Q04841" }, { "name": "Mpg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952", "id": "NP_034952" } ], "protein_names": [ { "name": "DNA-3-methyladenine glycosylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q04841" }, { "name": "3-alkyladenine DNA glycosylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04841" }, { "name": "3-methyladenine DNA glycosidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04841" }, { "name": "3.2.2.21", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04841" }, { "name": "ADPG; 3-alkyladenine DNA glycosylase; 3-methyladenine DNA glycosidase; alkylpurine-DNA-N-glycosylase; 3-methyladenine DNA glycosylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952", "id": "NP_034952" }, { "name": "ADPG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04841" }, { "name": "DNA-3-methyladenine glycosylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952", "id": "NP_034952" }, { "name": "N-methylpurine-DNA glycosylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04841" } ], "function": [ { "annotation": "Alkyladenine DNA glycosylase deficiency uncouples alkylation-induced strand break generation from PARP-1 activation and glycolysis inhibition. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034952", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952" }, { "database": "PubMed", "id": "32042007", "url": "https://glygen.org/publication/PubMed/32042007" } ] }, { "annotation": "Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841#function" } ] }, { "annotation": "ZEB1 promotes colitis and inflammatory CRC through the inhibition of MPG in epithelial cells, thus offering new therapeutic strategies to modulate inflammation and inflammatory cancer", "evidence": [ { "database": "RefSeq", "id": "NP_034952", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952" }, { "database": "PubMed", "id": "31366457", "url": "https://glygen.org/publication/PubMed/31366457" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mpg", "url": "https://www.uniprot.org/uniprot/Q04841", "locus": { "chromosome": "11", "start_pos": 32182700, "end_pos": 32176505, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020287", "url": "https://www.ensembl.org/id/ENSMUSG00000020287" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020287", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020287", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00540", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00540", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "268395", "url": "https://www.ncbi.nlm.nih.gov/gene/268395", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003180", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003180", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:268395", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:268395", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97073", "url": "http://www.informatics.jax.org/marker/MGI:97073", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q04841", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q04841", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PICAPRV", "url": "https://omabrowser.org/oma/group/PICAPRV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5483298at2759", "url": "http://www.orthodb.org/?query=5483298at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10429", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10429", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10429:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10429:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02245", "url": "http://pfam.xfam.org/family/PF02245", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q04841", "url": "http://purl.obolibrary.org/obo/PR_Q04841", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-110331", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110331", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-110357", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110357", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_034952", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F2Z3Y1", "url": "https://www.uniprot.org/uniprot/F2Z3Y1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3Y1-1", "url": "https://www.uniprot.org/uniprot/F2Z3Y1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q04841-1", "url": "https://www.uniprot.org/uniprot/Q04841-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPARGGSARPGRGALKPVSVTLLPDTEQPPFLGRARRPGNARAGSLVTGYHEVGQMPAPLSRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPEDHSGRLGPEFFDQPAVTLARAFLGQVLVRRLADGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVSSQGAGACVLLRALEPLEGLETMRQLRNSLRKSTVGRSLKDRELCSGPSKLCQALAIDKSFDQRDLAQDDAVWLEHGPLESSSPAVVVAAARIGIGHAGEWTQKPLRFYVQGSPWVSVVDRVAEQMDQPQQTACSEGLLIVQK", "length": 333, "header": "sp|Q04841-1|3MG_MOUSE Isoform 1 of DNA-3-methyladenine glycosylase OS=Mus musculus OX=10090 GN=Mpg PE=2 SV=3 CANONICAL=Q04841-1" }, "isoforms": [ { "isoform_ac": "F2Z3Y1-1", "url": "", "sequence": { "sequence": "MPARGGSARPGRGALKPVSVTLLPDTEQPPFLGRARRPGNARAGSLVTGYHEVGQMPAPLSRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPEDHSGRLGPEFFDQPAVTLARAFLGQCFQASMTNTGHLFSSTLPVTS", "length": 146, "header": "tr|F2Z3Y1-1|3MG_MOUSE Computationally mapped isoform of DNA-3-methyladenine glycosylase OS=Mus musculus OX=10090 GN=Mpg PE=2 SV=1 CANONICAL=Q04841-1" }, "locus": { "chromosome": "11", "start_pos": 32179309, "end_pos": 32176541, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000138050.2", "url": "https://www.ensembl.org/id/ENSMUST00000138050.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121960.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121960.2" } ] } }, { "isoform_ac": "Q04841-1", "url": "", "sequence": { "sequence": "MPARGGSARPGRGALKPVSVTLLPDTEQPPFLGRARRPGNARAGSLVTGYHEVGQMPAPLSRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPEDHSGRLGPEFFDQPAVTLARAFLGQVLVRRLADGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVSSQGAGACVLLRALEPLEGLETMRQLRNSLRKSTVGRSLKDRELCSGPSKLCQALAIDKSFDQRDLAQDDAVWLEHGPLESSSPAVVVAAARIGIGHAGEWTQKPLRFYVQGSPWVSVVDRVAEQMDQPQQTACSEGLLIVQK", "length": 333, "header": "sp|Q04841-1|3MG_MOUSE Isoform 1 of DNA-3-methyladenine glycosylase OS=Mus musculus OX=10090 GN=Mpg PE=2 SV=3 CANONICAL=Q04841-1" }, "locus": { "chromosome": "11", "start_pos": 32181992, "end_pos": 32176541, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020528", "url": "https://www.ensembl.org/id/ENSMUST00000020528" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020528", "url": "https://www.ensembl.org/id/ENSMUSP00000020528" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q04841", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q04841" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 272, "end_pos": 272, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "site_lbl": "Ser272" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "site_lbl": "Ser98" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q04841", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q04841" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "ZEB1 promotes inflammation and progression towards inflammation-driven carcinoma through repression of the DNA repair glycosylase MPG in epithelial cells.", "journal": "Gut", "date": "2019", "authors": "de Barrios O, Sanchez-Moral L, Cortes M, Ninfali C, Profitos-Peleja N, Martinez-Campanario MC, Siles L, Del Campo R, Fernandez-Acenero MJ, Darling DS, Castells A, Maurel J, Salas A, Dean DC, Postigo A", "evidence": [ { "database": "RefSeq", "id": "NP_034952", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952" } ], "reference": [ { "type": "PubMed", "id": "31366457", "url": "https://glygen.org/publication/PubMed/31366457" } ] }, { "title": "Alkyladenine DNA glycosylase deficiency uncouples alkylation-induced strand break generation from PARP-1 activation and glycolysis inhibition.", "journal": "Scientific reports", "date": "2020", "authors": "Alhumaydhi FA, de O Lopes D, Bordin DL, Aljohani ASM, Lloyd CB, McNicholas MD, Milano L, Charlier CF, Villela I, Henriques JAP, Plant KE, Elliott RM, Meira LB", "evidence": [ { "database": "RefSeq", "id": "NP_034952", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034952" } ], "reference": [ { "type": "PubMed", "id": "32042007", "url": "https://glygen.org/publication/PubMed/32042007" } ] }, { "title": "Structural organization of the mouse DNA repair gene, N-methylpurine-DNA glycosylase.", "journal": "DNA Cell Biol.", "date": "1995", "authors": "Ibeanu G.C., Mitra S., Izumi T., Ramana C.V., Kim N.K., Tatsuka M., Narayan S., Kang W., Roy G.", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "reference": [ { "type": "PubMed", "id": "7832991", "url": "https://glygen.org/publication/PubMed/7832991" } ] }, { "title": "Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse.", "journal": "Mamm. Genome", "date": "1993", "authors": "Kielman MF, Smits R, Devi TS, Fodde R, Bernini LF", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "reference": [ { "type": "PubMed", "id": "8318735", "url": "https://glygen.org/publication/PubMed/8318735" } ] }, { "title": "Cloning and characterization of a mouse 3-methyladenine/7-methyl-guanine/3-methylguanine DNA glycosylase cDNA whose gene maps to chromosome 11.", "journal": "Carcinogenesis", "date": "1993", "authors": "Samson L.D., Deng Z., Siciliano M.J., Boosalis M.S., Chen B.J., Engelward B.P.", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "reference": [ { "type": "PubMed", "id": "8435858", "url": "https://glygen.org/publication/PubMed/8435858" } ] }, { "title": "Structure of the mouse 3-methyladenine DNA glycosylase gene and exact localization upstream of the alpha-globin gene cluster on chromosome 11.", "journal": "Mamm. Genome", "date": "1995", "authors": "Bernini L.F., Kielman M.F., Smits R.", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "reference": [ { "type": "PubMed", "id": "8589517", "url": "https://glygen.org/publication/PubMed/8589517" } ] } ], "pathway": [ { "id": "mmu:268395", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:268395", "resource": "KEGG Pathway" }, { "id": "R-MMU-110331", "name": "Cleavage of the damaged purine", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110331", "resource": "Reactome", "description": "Cleavage of the damaged purine" }, { "id": "R-MMU-110357", "name": "Displacement of DNA glycosylase by APEX1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110357", "resource": "Reactome", "description": "Displacement of DNA glycosylase by APEX1" } ], "orthologs": [ { "uniprot_canonical_ac": "P29372-1", "protein_name": "DNA-3-methyladenine glycosylase", "gene_name": "MPG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA", "length": 298 }, "evidence": [ { "id": "45234388", "url": "http://www.informatics.jax.org/homology/45234388", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "alkylbase DNA N-glycosylase activity", "id": "GO:0003905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003905", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "DNA-3-methyladenine glycosylase activity", "id": "GO:0008725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008725", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "DNA-7-methylguanine glycosylase activity", "id": "GO:0043916", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043916", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "DNA-7-methyladenine glycosylase activity", "id": "GO:0052821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052821", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "DNA-3-methylguanine glycosylase activity", "id": "GO:0052822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052822", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" }, { "name": "mitochondrial nucleoid", "id": "GO:0042645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042645", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "base-excision repair", "id": "GO:0006284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006284", "evidence": [ { "database": "UniProtKB", "id": "Q04841", "url": "https://www.uniprot.org/uniprot/Q04841" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 189, "end_pos": 191, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-110248", "name": "Cleavage of 3-methyladenine by MPG glycosylase", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q04841-1" ], "evidence": [ { "id": "R-MMU-110248", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110248" } ] }, { "id": "R-MMU-110250", "name": "Cleavage of ethenoadenine by MPG glycosylase", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q04841-1" ], "evidence": [ { "id": "R-MMU-110250", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110250" } ] }, { "id": "R-MMU-110251", "name": "Cleavage of hypoxanthine by MPG glycosylase", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q04841-1" ], "evidence": [ { "id": "R-MMU-110251", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110251" } ] }, { "id": "R-MMU-110356", "name": "Displacement of MPG glycosylase by APEX1 at the AP site", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-MMU-49155" ], "enzyme_list": [ "P28352-1", "Q04841-1" ], "evidence": [ { "id": "R-MMU-110356", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110356" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-49155", "participant_name": "Mpg [nucleoplasm]", "crossref": [ { "id": "Q04841", "database": "UniProt", "url": "" }, { "id": "Q04841", "database": "PRO", "url": "" }, { "id": "97073", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000020528", "database": "Ensembl", "url": "" }, { "id": "NP_034952.2", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000020287", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000020528", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P28352", "gene_name": "Apex1", "activity": [ { "ec_number": "3.1.11.2", "activity": "Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates.", "evidence": [ { "id": "P28352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28352" } ] }, { "ec_number": "3.1.11.2", "activity": "", "evidence": [ { "id": "P28352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28352" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "P28352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28352" } ] } ] }, { "uniprot_ac": "Q04841", "gene_name": "Mpg", "activity": [ { "ec_number": "3.2.2.21", "activity": "Hydrolysis of alkylated DNA, releasing 3-methyladenine, 3-methylguanine, 7-methylguanine and 7-methyladenine.", "evidence": [ { "id": "Q04841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04841" } ] }, { "ec_number": "3.2.2.21", "activity": "", "evidence": [ { "id": "Q04841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04841" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }