{ "uniprot_canonical_ac": "Q04396-1", "uniprot_ac": "Q04396", "uniprot_id": "LPP1_YEAST", "mass": { "chemical_mass": 31586.0, "monoisotopic_mass": 31586.0 }, "refseq": { "ac": "NP_010791", "name": "phosphatidate phosphatase LPP1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010791" }, "gene_names": [ { "name": "LPP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q04396", "id": "Q04396" }, { "name": "D9719.9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q04396", "id": "Q04396" }, { "name": "LPP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010791", "id": "NP_010791" } ], "protein_names": [ { "name": "Lipid phosphate phosphatase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q04396" }, { "name": "3.1.3.106", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04396" }, { "name": "3.1.3.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04396" }, { "name": "3.6.1.75", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04396" }, { "name": "Lysophosphatidate phosphatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04396" }, { "name": "Phosphatidate phosphatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q04396" }, { "name": "phosphatidate phosphatase LPP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010791", "id": "NP_010791" } ], "function": [ { "annotation": "Catalyzes the dephosphorylation of diacylglycerol diphosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Together with DPP1, regulates intracellular DGPP and PA levels which are phospholipid molecules believed to play a signaling role in stress response. Can also use lysophosphatidic acid (LPA) as a substrate. Substrate preference is PA > DGPP > LPA.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396#function" }, { "database": "PubMed", "id": "9603941", "url": "https://glygen.org/publication/PubMed/9603941" }, { "database": "PubMed", "id": "10329682", "url": "https://glygen.org/publication/PubMed/10329682" }, { "database": "PubMed", "id": "10685032", "url": "https://glygen.org/publication/PubMed/10685032" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "common_name": "Yeast" } ], "gene": [ { "name": "LPP1", "url": "https://www.uniprot.org/uniprot/Q04396", "locus": {} } ], "crossref": [ { "id": "cd03390", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03390", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "852114", "url": "https://www.ncbi.nlm.nih.gov/gene/852114", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q04396", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q04396*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036938", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036938", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043216", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043216", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR503C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR503C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YGLDICQ", "url": "https://omabrowser.org/oma/group/YGLDICQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "25293at2759", "url": "http://www.orthodb.org/?query=25293at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10165", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10165", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10165:SF155", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10165:SF155", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01569", "url": "http://pfam.xfam.org/family/PF01569", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q04396", "url": "http://purl.obolibrary.org/obo/PR_Q04396", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010791", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010791", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002911", "url": "https://www.yeastgenome.org/locus/S000002911", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q04396-1", "url": "https://www.uniprot.org/uniprot/Q04396-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MISVMADEKHKEYFKLYYFQYMIIGLCTILFLYSEISLVPRGQNIEFSLDDPSISKRYVPNELVGPLECLILSVGLSNMVVFWTCMFDKDLLKKNRVKRLRERPDGISNDFHFMHTSILCLMLIISINAALTGALKLIIGNLRPDFVDRCIPDLQKMSDSDSLVFGLDICKQTNKWILYEGLKSTPSGHSSFIVSTMGFTYLWQRVFTTRNTRSCIWCPLLALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTNLAKRDILPSPVSV", "length": 274, "header": "sp|Q04396-1|LPP1_YEAST Isoform 1 of Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LPP1 PE=1 SV=1 CANONICAL=Q04396-1" }, "isoforms": [ { "isoform_ac": "Q04396-1", "url": "", "sequence": { "sequence": "MISVMADEKHKEYFKLYYFQYMIIGLCTILFLYSEISLVPRGQNIEFSLDDPSISKRYVPNELVGPLECLILSVGLSNMVVFWTCMFDKDLLKKNRVKRLRERPDGISNDFHFMHTSILCLMLIISINAALTGALKLIIGNLRPDFVDRCIPDLQKMSDSDSLVFGLDICKQTNKWILYEGLKSTPSGHSSFIVSTMGFTYLWQRVFTTRNTRSCIWCPLLALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTNLAKRDILPSPVSV", "length": 274, "header": "sp|Q04396-1|LPP1_YEAST Isoform 1 of Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=LPP1 PE=1 SV=1 CANONICAL=Q04396-1" }, "locus": { "chromosome": "IV", "start_pos": 1455866, "end_pos": 1455045, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR503C_mRNA", "url": "https://www.ensembl.org/id/YDR503C_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR503C", "url": "https://www.ensembl.org/id/YDR503C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The LPP1 and DPP1 gene products account for most of the isoprenoid phosphate phosphatase activities in Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Chen X., Rush J., Waechter C.J., Sternweis P.C., Carman G.M., Faulkner A., Horazdovsky B.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "10329682", "url": "https://glygen.org/publication/PubMed/10329682" } ] }, { "title": "Enzymological properties of the LPP1-encoded lipid phosphatase from Saccharomyces cerevisiae.", "journal": "Biochim. Biophys. Acta", "date": "2000", "authors": "Carman G.M., Furneisen J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "10685032", "url": "https://glygen.org/publication/PubMed/10685032" } ] }, { "title": "Transmembrane topology of sphingoid long-chain base-1-phosphate phosphatase, Lcb3p.", "journal": "Genes Cells", "date": "2003", "authors": "Kihara Akio, Sano Takamitsu, Iwaki Soichiro, Igarashi Yasuyuki", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "12786943", "url": "https://glygen.org/publication/PubMed/12786943" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] }, { "title": "Isolation and characterization of the Saccharomyces cerevisiae LPP1 gene encoding a Mg2+-independent phosphatidate phosphatase.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Wu W.I., Carman G.M., Voelker D.R., Bennett W.L., Oshiro J., Toke D.A.", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "reference": [ { "type": "PubMed", "id": "9603941", "url": "https://glygen.org/publication/PubMed/9603941" } ] } ], "pathway": [ { "id": "sce:YDR503C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR503C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "phospholipid metabolic process", "id": "GO:0006644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006644", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "phosphatidate phosphatase activity", "id": "GO:0008195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008195", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "pmid": "" }, { "name": "diacylglycerol diphosphate phosphatase activity", "id": "GO:0000810", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000810", "evidence": [ { "database": "UniProtKB", "id": "Q04396", "url": "https://www.uniprot.org/uniprot/Q04396" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "27429", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "D3ZYB4-1", "A0A0G2JW03-1", "A0A8I6AUU1-1", "Q92539-1", "Q14693-1", "Q9BQK8-1", "Q8NEB5-1", "O14494-1", "O14495-1", "O43688-1", "Q5VZY2-1", "Q91ZP3-1", "Q99PI4-1", "Q99PI5-1", "Q61469-1", "Q99JY8-1", "Q0VBU9-1", "Q3UMZ3-1", "Q9DAX2-1", "P53933-1", "P32567-1", "Q04396-1", "Q05521-1", "Q9V576-1", "Q8SXP0-1" ], "evidence": [ { "id": "27429", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27429" } ] }, { "id": "27449", "name": "", "equation": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "Q8NEB5-1", "O14494-1", "Q5VZY2-1", "Q0VBU9-1", "Q61469-1", "Q3UMZ3-1", "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "27449", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27449" } ] }, { "id": "33155", "name": "", "equation": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "O14494-1", "Q61469-1", "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "33155", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33155" } ] }, { "id": "R-SCE-2029468", "name": "Conversion of PA into DAG by PAP-1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [ "R-ALL-1602448" ], "output_participant_list": [ "R-ALL-112275" ], "enzyme_list": [ "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "R-SCE-2029468", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-2029468" } ] }, { "id": "R-SCE-428690", "name": "sphingosine 1-phosphate + H2O => sphingosine + orthophosphate [extracellular]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-109276", "R-ALL-419305" ], "output_participant_list": [ "R-ALL-109277", "R-ALL-428662" ], "enzyme_list": [ "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "R-SCE-428690", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-428690" } ] }, { "id": "R-SCE-428696", "name": "sphingosine 1-phosphate + H2O => sphingosine + orthophosphate [cytosolic - PPAP]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-428682" ], "enzyme_list": [ "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "R-SCE-428696", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-428696" } ] }, { "id": "R-SCE-6797630", "name": "LRPP4(LRPP1-3,5) hydrolyse LPA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-417891" ], "output_participant_list": [ "R-ALL-6797635" ], "enzyme_list": [ "Q04396-1", "Q05521-1" ], "evidence": [ { "id": "R-SCE-6797630", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SCE-6797630" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-109276", "participant_name": "H2O [extracellular region]", "crossref": [ { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-109277", "participant_name": "Pi [extracellular region]", "crossref": [ { "id": "C00009", "database": "COMPOUND", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "C00009", "database": "COMPOUND", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "C00009", "database": "COMPOUND", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "C00009", "database": "COMPOUND", "url": "" }, { "id": "C00009", "database": "COMPOUND", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "43474", "database": "ChEBI", "url": "" }, { "id": "C00009", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-112275", "participant_name": "DAGs [plasma membrane]", "crossref": [ { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "18035", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602448", "participant_name": "PA [plasma membrane]", "crossref": [ { "id": "C00416", "database": "COMPOUND", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "C00416", "database": "COMPOUND", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "C00416", "database": "COMPOUND", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "C00416", "database": "COMPOUND", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "C00416", "database": "COMPOUND", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "57739", "database": "ChEBI", "url": "" }, { "id": "C00416", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-417891", "participant_name": "LPA [extracellular region]", "crossref": [ { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" }, { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" }, { "id": "000014953268", "database": "ZINC", "url": "" }, { "id": "52288", "database": "ChEBI", "url": "" }, { "id": "HMDB0242470", "database": "HMDB Metabolite", "url": "" }, { "id": "000014953257", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-419305", "participant_name": "S1P [extracellular region]", "crossref": [ { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-428662", "participant_name": "SPG [extracellular region]", "crossref": [ { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-428682", "participant_name": "SPG [cytosol]", "crossref": [ { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-6797635", "participant_name": "1,2-DAG [extracellular region]", "crossref": [ { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JW03", "gene_name": "Lpin1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "A0A0G2JW03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW03" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "A0A0G2JW03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW03" } ] } ] }, { "uniprot_ac": "A0A8I6AUU1", "gene_name": "Lpin3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "A0A8I6AUU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUU1" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "A0A8I6AUU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUU1" } ] } ] }, { "uniprot_ac": "D3ZYB4", "gene_name": "Lpin2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "D3ZYB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZYB4" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "D3ZYB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZYB4" } ] } ] }, { "uniprot_ac": "O08564", "gene_name": "Plpp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] } ] }, { "uniprot_ac": "O14494", "gene_name": "PLPP1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] } ] }, { "uniprot_ac": "O14495", "gene_name": "PLPP3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] } ] }, { "uniprot_ac": "O43688", "gene_name": "PLPP2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] } ] }, { "uniprot_ac": "P32567", "gene_name": "PAH1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P32567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32567" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P32567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32567" } ] } ] }, { "uniprot_ac": "P53933", "gene_name": "APP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P53933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53933" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P53933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53933" } ] } ] }, { "uniprot_ac": "P97544", "gene_name": "Plpp3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] } ] }, { "uniprot_ac": "Q04396", "gene_name": "LPP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] } ] }, { "uniprot_ac": "Q05521", "gene_name": "DPP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] } ] }, { "uniprot_ac": "Q0VBU9", "gene_name": "Plpp4", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] } ] }, { "uniprot_ac": "Q14693", "gene_name": "LPIN1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q14693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14693" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q14693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14693" } ] } ] }, { "uniprot_ac": "Q3UMZ3", "gene_name": "Plpp5", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] } ] }, { "uniprot_ac": "Q5VZY2", "gene_name": "PLPP4", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] } ] }, { "uniprot_ac": "Q61469", "gene_name": "Plpp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] } ] }, { "uniprot_ac": "Q8K593", "gene_name": "Plpp2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] } ] }, { "uniprot_ac": "Q8NEB5", "gene_name": "PLPP5", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] } ] }, { "uniprot_ac": "Q8SXP0", "gene_name": "Lpin", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8SXP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXP0" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8SXP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXP0" } ] } ] }, { "uniprot_ac": "Q91ZP3", "gene_name": "Lpin1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q91ZP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZP3" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q91ZP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZP3" } ] } ] }, { "uniprot_ac": "Q92539", "gene_name": "LPIN2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q92539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92539" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q92539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92539" } ] } ] }, { "uniprot_ac": "Q99JY8", "gene_name": "Plpp3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] } ] }, { "uniprot_ac": "Q99PI4", "gene_name": "Lpin3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99PI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI4" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99PI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI4" } ] } ] }, { "uniprot_ac": "Q99PI5", "gene_name": "Lpin2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99PI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI5" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99PI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI5" } ] } ] }, { "uniprot_ac": "Q9BQK8", "gene_name": "LPIN3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9BQK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQK8" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9BQK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQK8" } ] } ] }, { "uniprot_ac": "Q9DAX2", "gene_name": "Plpp2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] } ] }, { "uniprot_ac": "Q9V576", "gene_name": "wun", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }