{ "uniprot_canonical_ac": "Q03774-1", "uniprot_ac": "Q03774", "uniprot_id": "TRM82_YEAST", "mass": { "chemical_mass": 50488.0, "monoisotopic_mass": 50488.0 }, "refseq": { "ac": "NP_010449", "name": "Trm82p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010449" }, "gene_names": [ { "name": "TRM82", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q03774", "id": "Q03774" }, { "name": "TRM82", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010449", "id": "NP_010449" }, { "name": "YD8358.19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q03774", "id": "Q03774" } ], "protein_names": [ { "name": "tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q03774" }, { "name": "Transfer RNA methyltransferase 82", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q03774" }, { "name": "Trm82p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010449", "id": "NP_010449" } ], "function": [ { "annotation": "Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA, a modification required to maintain stability of tRNAs; its absence resulting in tRNA decay. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774#function" }, { "database": "UniProtKB", "id": "MF_03056", "url": "https://www.uniprot.org/uniprot/MF_03056#function" }, { "database": "PubMed", "id": "18184583", "url": "https://glygen.org/publication/PubMed/18184583" }, { "database": "PubMed", "id": "17382321", "url": "https://glygen.org/publication/PubMed/17382321" }, { "database": "PubMed", "id": "16387656", "url": "https://glygen.org/publication/PubMed/16387656" }, { "database": "PubMed", "id": "15811913", "url": "https://glygen.org/publication/PubMed/15811913" }, { "database": "PubMed", "id": "26416026", "url": "https://glygen.org/publication/PubMed/26416026" } ] } ], "disease": [ { "disease_id": "DOID:0050569", "recommended_name": { "id": "DOID:0050569", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050569", "name": "Seckel syndrome", "description": "A syndrome characterized by intrauterine growth retardation and postnatal dwarfism with microcephaly and intellectual disability." }, "synonyms": [ { "id": "DOID:0050569", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050569", "name": "Harper's syndrome", "description": "" }, { "id": "DOID:0050569", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050569", "name": "Virchow-Seckel dwarfism", "description": "" }, { "id": "DOID:0050569", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050569", "name": "bird-headed dwarfism", "description": "" }, { "id": "DOID:0050569", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050569", "name": "microcephalic primordial dwarfism", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel syndrome 1", "description": "Any Seckel syndrome in which the cause of the disease is a mutation in the ATR gene." }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "ATR Seckel syndrome", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "SCKL1", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel syndrome 1", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel syndrome 3", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel syndrome caused by mutation in ATR", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel syndrome type 1", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "microcephalic primordial dwarfism I", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Bird-headed dwarfism", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Sckl", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "Seckel-type dwarfism", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "microcephalic primordial dwarfism 1", "description": "" }, { "id": "MONDO:0008869", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008869", "name": "nanocephalic dwarfism", "description": "" }, { "id": "MIM:210600", "resource": "MIM", "url": "https://www.omim.org/entry/210600", "name": "Seckel syndrome 1", "description": "Seckel syndrome 1" } ], "evidence": [ { "id": "0050569", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050569" } ] }, { "disease_id": "DOID:0080694", "recommended_name": { "id": "DOID:0080694", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080694", "name": "Galloway-Mowat syndrome", "description": "A syndrome that is characterized by developmental delay, progressive microcephaly, cerebral and cerebellar atrophy with extrapyramidal involvement, and optic atrophy." }, "synonyms": [ { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway-Mowat syndrome 1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway-Mowat syndrome 1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "GAMOS1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "cerebellar ataxia with intellectual disability, optic atrophy, and skin abnormalities", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "cerebellar ataxia with mental retardation, optic atrophy, and skin abnormalities", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "microcephaly, hiatal hernia, and nephrotic syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "nephrosis-microcephaly syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "nephrosis-neuronal dysmigration syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "spinocerebellar ataxia, autosomal recessive 5", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "spinocerebellar ataxia, autosomal recessive 5, formerly", "description": "" }, { "id": "MIM:251300", "resource": "MIM", "url": "https://www.omim.org/entry/251300", "name": "Galloway-Mowat syndrome 1", "description": "Galloway-Mowat syndrome 1" } ], "evidence": [ { "id": "0080694", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080694" } ] }, { "disease_id": "DOID:0081051", "recommended_name": { "id": "DOID:0081051", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081051", "name": "microcephaly, growth deficiency, seizures, and brain malformations", "description": "A syndrome that is characterized by intrauterine growth retardation, postnatal growth deficiency with severe microcephaly, and poor or absent psychomotor development, and that has_material_basis_in homozygous mutation in the WDR4 gene on chromosome 21q22." }, "synonyms": [ { "id": "MONDO:0032690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032690", "name": "microcephaly, growth deficiency, seizures, and brain malformations", "description": "" }, { "id": "MONDO:0032690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032690", "name": "MICROCEPHALY, GROWTH DEFICIENCY, SEIZURES, AND BRAIN MALFORMATIONS", "description": "" }, { "id": "MONDO:0032690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032690", "name": "MIGSB", "description": "" }, { "id": "MIM:618346", "resource": "MIM", "url": "https://www.omim.org/entry/618346", "name": "Microcephaly, growth deficiency, seizures, and brain malformations", "description": "Microcephaly, growth deficiency, seizures, and brain malformations" } ], "evidence": [ { "id": "0081051", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081051" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 223, "end_pos": 223, "sequence_org": "K", "sequence_mut": "L", "comment": "Decreased tRNA methylation.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" }, { "database": "PubMed", "id": "26416026", "url": "https://glygen.org/publication/PubMed/26416026" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TRM82", "url": "https://www.uniprot.org/uniprot/Q03774", "locus": {} } ], "crossref": [ { "id": "2.1.1.33", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.33&UniProtAcc=Q03774", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "851743", "url": "https://www.ncbi.nlm.nih.gov/gene/851743", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q03774", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q03774*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001680", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001680", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR165W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR165W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PPIYNYI", "url": "https://omabrowser.org/oma/group/PPIYNYI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5480021at2759", "url": "http://www.orthodb.org/?query=5480021at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16288", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16288", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16288:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16288:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2VDU", "url": "https://www.rcsb.org/structure/2VDU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PR_Q03774", "url": "http://purl.obolibrary.org/obo/PR_Q03774", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010449", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010449", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002572", "url": "https://www.yeastgenome.org/locus/S000002572", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q03774-1", "url": "https://www.uniprot.org/uniprot/Q03774-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSVIHPLQNLLTSRDGSLVFAIIKNCILSFKYQSPNHWEFAGKWSDDFDKIQESRNTTAKEQQGQSSENENENKKLKSNKGDSIKRTAAKVPSPGLGAPPIYSYIRNLRLTSDESRLIACADSDKSLLVFDVDKTSKNVLKLRKRFCFSKRPNAISIAEDDTTVIIADKFGDVYSIDINSIPEEKFTQEPILGHVSMLTDVHLIKDSDGHQFIITSDRDEHIKISHYPQCFIVDKWLFGHKHFVSSICCGKDYLLLSAGGDDKIFAWDWKTGKNLSTFDYNSLIKPYLNDQHLAPPRFQNENNDIIEFAVSKIIKSKNLPFVAFFVEATKCIIILEMSEKQKGDLALKQIITFPYNVISLSAHNDEFQVTLDNKESSGVQKNFAKFIEYNLNENSFVVNNEKSNEFDSAIIQSVQGDSNLVTKKEEIYPLYNVSSLRKHGEHYS", "length": 444, "header": "sp|Q03774-1|TRM82_YEAST Isoform 1 of tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TRM82 PE=1 SV=1 CANONICAL=Q03774-1" }, "isoforms": [ { "isoform_ac": "Q03774-1", "url": "", "sequence": { "sequence": "MSVIHPLQNLLTSRDGSLVFAIIKNCILSFKYQSPNHWEFAGKWSDDFDKIQESRNTTAKEQQGQSSENENENKKLKSNKGDSIKRTAAKVPSPGLGAPPIYSYIRNLRLTSDESRLIACADSDKSLLVFDVDKTSKNVLKLRKRFCFSKRPNAISIAEDDTTVIIADKFGDVYSIDINSIPEEKFTQEPILGHVSMLTDVHLIKDSDGHQFIITSDRDEHIKISHYPQCFIVDKWLFGHKHFVSSICCGKDYLLLSAGGDDKIFAWDWKTGKNLSTFDYNSLIKPYLNDQHLAPPRFQNENNDIIEFAVSKIIKSKNLPFVAFFVEATKCIIILEMSEKQKGDLALKQIITFPYNVISLSAHNDEFQVTLDNKESSGVQKNFAKFIEYNLNENSFVVNNEKSNEFDSAIIQSVQGDSNLVTKKEEIYPLYNVSSLRKHGEHYS", "length": 444, "header": "sp|Q03774-1|TRM82_YEAST Isoform 1 of tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82 OS=Saccharomyces cerevisiae S288C OX=559292 GN=TRM82 PE=1 SV=1 CANONICAL=Q03774-1" }, "locus": { "chromosome": "IV", "start_pos": 786202, "end_pos": 784871, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR165W_mRNA", "url": "https://www.ensembl.org/id/YDR165W_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR165W", "url": "https://www.ensembl.org/id/YDR165W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser66" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser67" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" }, { "database": "SGD", "id": "Q03774", "url": "https://www.yeastgenome.org/locus/Q03774" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser93" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA.", "journal": "RNA", "date": "2002", "authors": "Alexandrov A, Martzen MR, Phizicky EM", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "12403464", "url": "https://glygen.org/publication/PubMed/12403464" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "tRNA m7G methyltransferase Trm8p/Trm82p: evidence linking activity to a growth phenotype and implicating Trm82p in maintaining levels of active Trm8p.", "journal": "RNA", "date": "2005", "authors": "Alexandrov Andrei, Grayhack Elizabeth J, Phizicky Eric M", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "15811913", "url": "https://glygen.org/publication/PubMed/15811913" } ] }, { "title": "Rapid tRNA decay can result from lack of nonessential modifications.", "journal": "Mol. Cell", "date": "2006", "authors": "Gu W., Hughes T.R., Alexandrov A., Phizicky E.M., Grayhack E.J., Hiley S.L., Chernyakov I.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "16387656", "url": "https://glygen.org/publication/PubMed/16387656" } ] }, { "title": "RNA recognition mechanism of eukaryote tRNA (m7G46) methyltransferase (Trm8-Trm82 complex).", "journal": "FEBS Lett.", "date": "2007", "authors": "Matsumoto Keisuke, Toyooka Takashi, Tomikawa Chie, Ochi Anna, Takano Yoshitaka, Takayanagi Naoyuki, Endo Yaeta, Hori Hiroyuki", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "17382321", "url": "https://glygen.org/publication/PubMed/17382321" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "Structure of the yeast tRNA m7G methylation complex.", "journal": "Structure", "date": "2008", "authors": "Blondeau K., van Tilbeurgh H., Leulliot N., Ulryck N., Durand D., Chaillet M.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "18184583", "url": "https://glygen.org/publication/PubMed/18184583" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" }, { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "22814378", "url": "https://glygen.org/publication/PubMed/22814378" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "Q03774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03774" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism.", "journal": "Genome Biol.", "date": "2015", "authors": "Shaheen R, Abdel-Salam GM, Guy MP, Alomar R, Abdel-Hamid MS, Afifi HH, Ismail SI, Emam BA, Phizicky EM, Alkuraya FS", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "26416026", "url": "https://glygen.org/publication/PubMed/26416026" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR165W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR165W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "tRNA methyltransferase complex", "id": "GO:0043527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043527", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "tRNA (m7G46) methyltransferase complex", "id": "GO:0106143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106143", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "tRNA modification", "id": "GO:0006400", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006400", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "tRNA methylation", "id": "GO:0030488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030488", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" }, { "name": "tRNA (guanine-N7)-methylation", "id": "GO:0106004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106004", "evidence": [ { "database": "UniProtKB", "id": "Q03774", "url": "https://www.uniprot.org/uniprot/Q03774" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 274, "end_pos": 276, "annotation": "n_glycosylation_sequon" }, { "start_pos": 432, "end_pos": 434, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }