{ "uniprot_canonical_ac": "Q03687-1", "uniprot_ac": "Q03687", "uniprot_id": "ANY1_YEAST", "mass": { "chemical_mass": 46872.0, "monoisotopic_mass": 46872.0 }, "refseq": { "ac": "NP_013723", "name": "Any1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013723" }, "gene_names": [ { "name": "ANY1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q03687", "id": "Q03687" }, { "name": "ANY1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013723", "id": "NP_013723" }, { "name": "CFS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013723", "id": "NP_013723" }, { "name": "CFS1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q03687", "id": "Q03687" }, { "name": "YM8270.13", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q03687", "id": "Q03687" } ], "protein_names": [ { "name": "Scramblase ANY1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q03687" }, { "name": "Antagonizes NEO1 phospholipid flippase protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q03687" }, { "name": "Any1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013723", "id": "NP_013723" }, { "name": "CDC50 suppressor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q03687" } ], "function": [ { "annotation": "Phospholipid scramblase that transports phosphatidylserine (PS) and phosphatidylethalonamine (PE) bidirectionally from one leaflet to the other of the phospholipid bilayer to at least partially collapse the membrane asymmetry established by NEO1 and other flippases (PubMed:27811238, PubMed:28057802, PubMed:30824614). The PS scramblase activity has been disputed (PubMed:30824614). Functions in the trafficking pathway from endosomes to the trans-Golgi network (TGN) (PubMed:28057802).", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687#function" }, { "database": "PubMed", "id": "30824614", "url": "https://glygen.org/publication/PubMed/30824614" }, { "database": "PubMed", "id": "28057802", "url": "https://glygen.org/publication/PubMed/28057802" }, { "database": "PubMed", "id": "27811238", "url": "https://glygen.org/publication/PubMed/27811238" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 258, "end_pos": 405, "sequence_org": "SLGLLVESLLPLPQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQYIYYRYYYPKLRHQHHPNDSNSPSDEDESEMYELDLFNTLQKDVEKALKQDSNDTSDSPQDDQVGKSQAQAVTL", "sequence_mut": "", "comment": "Suppresses the growth defects caused by mutations of flippases.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" }, { "database": "PubMed", "id": "27811238", "url": "https://glygen.org/publication/PubMed/27811238" } ] }, { "start_pos": 80, "end_pos": 80, "sequence_org": "G", "sequence_mut": "R", "comment": "Suppresses the growth defects caused by mutations of flippases.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" }, { "database": "PubMed", "id": "27811238", "url": "https://glygen.org/publication/PubMed/27811238" } ] }, { "start_pos": 84, "end_pos": 84, "sequence_org": "D", "sequence_mut": "G", "comment": "Abolishes its physical interaction with NEO1. Suppresses the growth defects caused by mutations of flippases.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" }, { "database": "PubMed", "id": "30824614", "url": "https://glygen.org/publication/PubMed/30824614" }, { "database": "PubMed", "id": "27811238", "url": "https://glygen.org/publication/PubMed/27811238" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ANY1", "url": "https://www.uniprot.org/uniprot/Q03687", "locus": {} } ], "crossref": [ { "id": "855022", "url": "https://www.ncbi.nlm.nih.gov/gene/855022", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q03687", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q03687*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006603", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006603", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YMR010W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YMR010W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QMSLDIY", "url": "https://omabrowser.org/oma/group/QMSLDIY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "179669at2759", "url": "http://www.orthodb.org/?query=179669at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14856", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14856", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14856:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14856:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04193", "url": "http://pfam.xfam.org/family/PF04193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q03687", "url": "http://purl.obolibrary.org/obo/PR_Q03687", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013723", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013723", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004612", "url": "https://www.yeastgenome.org/locus/S000004612", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q03687-1", "url": "https://www.uniprot.org/uniprot/Q03687-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTTGPLDATLIRDVAVATATKASYDMSDTLYSYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATMLIASILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHLIHDIWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRIGAFWQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPLPQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQYIYYRYYYPKLRHQHHPNDSNSPSDEDESEMYELDLFNTLQKDVEKALKQDSNDTSDSPQDDQVGKSQAQAVTL", "length": 405, "header": "sp|Q03687-1|ANY1_YEAST Isoform 1 of Scramblase ANY1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ANY1 PE=1 SV=1 CANONICAL=Q03687-1" }, "isoforms": [ { "isoform_ac": "Q03687-1", "url": "", "sequence": { "sequence": "MSTTGPLDATLIRDVAVATATKASYDMSDTLYSYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATMLIASILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHLIHDIWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRIGAFWQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPLPQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQYIYYRYYYPKLRHQHHPNDSNSPSDEDESEMYELDLFNTLQKDVEKALKQDSNDTSDSPQDDQVGKSQAQAVTL", "length": 405, "header": "sp|Q03687-1|ANY1_YEAST Isoform 1 of Scramblase ANY1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=ANY1 PE=1 SV=1 CANONICAL=Q03687-1" }, "locus": { "chromosome": "XIII", "start_pos": 286314, "end_pos": 285100, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YMR010W_mRNA", "url": "https://www.ensembl.org/id/YMR010W_mRNA" }, { "database": "Ensembl Peptide", "id": "YMR010W", "url": "https://www.ensembl.org/id/YMR010W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q03687", "url": "https://www.yeastgenome.org/locus/Q03687" }, { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser351" }, { "start_pos": 353, "end_pos": 353, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q03687", "url": "https://www.yeastgenome.org/locus/Q03687" }, { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser353" }, { "start_pos": 355, "end_pos": 355, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q03687", "url": "https://www.yeastgenome.org/locus/Q03687" }, { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser355" }, { "start_pos": 387, "end_pos": 387, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q03687", "url": "https://www.yeastgenome.org/locus/Q03687" }, { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser387" }, { "start_pos": 389, "end_pos": 389, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "Q03687", "url": "https://www.yeastgenome.org/locus/Q03687" }, { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser389" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A global topology map of the Saccharomyces cerevisiae membrane proteome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Kim H., von Heijne G., Melen K., Oesterberg M.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "16847258", "url": "https://glygen.org/publication/PubMed/16847258" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "Q03687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03687" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Cfs1p, a Novel Membrane Protein in the PQ-Loop Family, Is Involved in Phospholipid Flippase Functions in Yeast.", "journal": "G3 (Bethesda)", "date": "2017", "authors": "Tanaka K., Yamamoto T., Suzuki R., Fujimura-Kamada K., Shioji E.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "28057802", "url": "https://glygen.org/publication/PubMed/28057802" } ] }, { "title": "The PQ-loop protein Any1 segregates Drs2 and Neo1 functions required for viability and plasma membrane phospholipid asymmetry.", "journal": "J. Lipid Res.", "date": "2019", "authors": "Takar M, Huang Y, Graham TR", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "30824614", "url": "https://glygen.org/publication/PubMed/30824614" } ] }, { "title": "Conserved mechanism of phospholipid substrate recognition by the P4-ATPase Neo1 from Saccharomyces cerevisiae.", "journal": "Biochim. Biophys. Acta", "date": "2020", "authors": "Huang Y, Takar M, Best JT, Graham TR", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "31786280", "url": "https://glygen.org/publication/PubMed/31786280" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Pearson D., Bowman S., Hunt S., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Badcock K., Chillingworth T., Churcher C.M., Dedman K., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Walsh S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "reference": [ { "type": "PubMed", "id": "9169872", "url": "https://glygen.org/publication/PubMed/9169872" } ] } ], "pathway": [ { "id": "sce:YMR010W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YMR010W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "trans-Golgi network membrane", "id": "GO:0032588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032588", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "phospholipid translocation", "id": "GO:0045332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045332", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" }, { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "Q03687", "url": "https://www.uniprot.org/uniprot/Q03687" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 309, "end_pos": 311, "annotation": "n_glycosylation_sequon" }, { "start_pos": 349, "end_pos": 351, "annotation": "n_glycosylation_sequon" }, { "start_pos": 384, "end_pos": 386, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }