{ "uniprot_canonical_ac": "Q03246-1", "uniprot_ac": "Q03246", "uniprot_id": "RT17_YEAST", "mass": { "chemical_mass": 27635.0, "monoisotopic_mass": 27635.0 }, "refseq": { "ac": "NP_013913", "name": "mitochondrial 37S ribosomal protein MRPS17", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013913" }, "gene_names": [ { "name": "MRPS17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q03246", "id": "Q03246" }, { "name": "MRPS17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013913", "id": "NP_013913" }, { "name": "YM8010.18C", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q03246", "id": "Q03246" }, { "name": "uS17m", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013913", "id": "NP_013913" } ], "protein_names": [ { "name": "Small ribosomal subunit protein uS17m", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q03246" }, { "name": "37S ribosomal protein S17, mitochondrial", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q03246" }, { "name": "mitochondrial 37S ribosomal protein MRPS17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013913", "id": "NP_013913" } ], "function": [ { "annotation": "Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane (PubMed:25609543, PubMed:28154081). uS17m may have a meiosis-specific role as it accumulates during the middle stage of sporulation (PubMed:15543521).", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246#function" }, { "database": "PubMed", "id": "15543521", "url": "https://glygen.org/publication/PubMed/15543521" }, { "database": "PubMed", "id": "25609543", "url": "https://glygen.org/publication/PubMed/25609543" }, { "database": "PubMed", "id": "28154081", "url": "https://glygen.org/publication/PubMed/28154081" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MRPS17", "url": "https://www.uniprot.org/uniprot/Q03246", "locus": {} } ], "crossref": [ { "id": "855226", "url": "https://www.ncbi.nlm.nih.gov/gene/855226", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q03246", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q03246*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000266", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000266", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YMR188C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YMR188C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IRNKGQQ", "url": "https://omabrowser.org/oma/group/IRNKGQQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "297148at2759", "url": "http://www.orthodb.org/?query=297148at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10744", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10744", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10744:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10744:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5MRC", "url": "https://www.rcsb.org/structure/5MRC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MRE", "url": "https://www.rcsb.org/structure/5MRE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MRF", "url": "https://www.rcsb.org/structure/5MRF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8D8J", "url": "https://www.rcsb.org/structure/8D8J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8D8K", "url": "https://www.rcsb.org/structure/8D8K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8D8L", "url": "https://www.rcsb.org/structure/8D8L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00366", "url": "http://pfam.xfam.org/family/PF00366", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q03246", "url": "http://purl.obolibrary.org/obo/PR_Q03246", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013913", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013913", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004800", "url": "https://www.yeastgenome.org/locus/S000004800", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q03246-1", "url": "https://www.uniprot.org/uniprot/Q03246-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARQNFLGLVVSQGKMQKTVKVRVETKVFNKKINKELFHRRDYLVHDEGEISREGDLVRIEATRPLSKRKFFAIAEIIRNKGQQFALYESEAQLSVAKEEAQKAKEFLDKRSVRENKLNEKTTLLRDIRTIQDALSSGSTPKELLEIKQRYGIQDFSQETVRQLLQLDISGLEVNLEKQRSLIDRIQTRLSELLSNDLKCDQFLKDHGVEDPLTLKKNIKKNLLRKHVMMDMQQPSQ", "length": 237, "header": "sp|Q03246-1|RT17_YEAST Isoform 1 of Small ribosomal subunit protein uS17m OS=Saccharomyces cerevisiae S288C OX=559292 GN=MRPS17 PE=1 SV=1 CANONICAL=Q03246-1" }, "isoforms": [ { "isoform_ac": "Q03246-1", "url": "", "sequence": { "sequence": "MARQNFLGLVVSQGKMQKTVKVRVETKVFNKKINKELFHRRDYLVHDEGEISREGDLVRIEATRPLSKRKFFAIAEIIRNKGQQFALYESEAQLSVAKEEAQKAKEFLDKRSVRENKLNEKTTLLRDIRTIQDALSSGSTPKELLEIKQRYGIQDFSQETVRQLLQLDISGLEVNLEKQRSLIDRIQTRLSELLSNDLKCDQFLKDHGVEDPLTLKKNIKKNLLRKHVMMDMQQPSQ", "length": 237, "header": "sp|Q03246-1|RT17_YEAST Isoform 1 of Small ribosomal subunit protein uS17m OS=Saccharomyces cerevisiae S288C OX=559292 GN=MRPS17 PE=1 SV=1 CANONICAL=Q03246-1" }, "locus": { "chromosome": "XIII", "start_pos": 637004, "end_pos": 636294, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YMR188C_mRNA", "url": "https://www.ensembl.org/id/YMR188C_mRNA" }, { "database": "Ensembl Peptide", "id": "YMR188C", "url": "https://www.ensembl.org/id/YMR188C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Tag-mediated isolation of yeast mitochondrial ribosome and mass spectrometric identification of its new components.", "journal": "Eur. J. Biochem.", "date": "2002", "authors": "Oshiro N., Gan X., Yoshino K., Yonezawa K., Isono K., Kitakawa M.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "12392552", "url": "https://glygen.org/publication/PubMed/12392552" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The proteome of Saccharomyces cerevisiae mitochondria.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Sickmann A., Zahedi R.P., Rehling P., Chacinska A., Guiard B., Meyer H.E., Meisinger C., Reinders J., Pfanner N., Joppich C., Perschil I., Schoenfisch B., Wagner Y.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "14576278", "url": "https://glygen.org/publication/PubMed/14576278" } ] }, { "title": "Analysis of the meiotic role of the mitochondrial ribosomal proteins Mrps17 and Mrpl37 in Saccharomyces cerevisiae.", "journal": "Yeast", "date": "2004", "authors": "Xu Z., Vershon A.K., Hanlon S.E., Norris D.N.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "15543521", "url": "https://glygen.org/publication/PubMed/15543521" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Organization of the mitochondrial translation machinery studied in situ by cryoelectron tomography.", "journal": "Nat. Commun.", "date": "2015", "authors": "Herrmann J.M., Woellhaf M.W., Pfeffer S., Forster F.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "25609543", "url": "https://glygen.org/publication/PubMed/25609543" } ] }, { "title": "The structure of the yeast mitochondrial ribosome.", "journal": "Science", "date": "2017", "authors": "Brown A., Amunts A., Ramakrishnan V., Desai N.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "28154081", "url": "https://glygen.org/publication/PubMed/28154081" } ] }, { "title": "Genetics of the synthesis of serine from glycine and the utilization of glycine as sole nitrogen source by Saccharomyces cerevisiae.", "journal": "Genetics", "date": "1995", "authors": "Sinclair D.A., Dawes I.W.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "7498764", "url": "https://glygen.org/publication/PubMed/7498764" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.", "journal": "Nature", "date": "1997", "authors": "Connor R., Gentles S., Pearson D., Bowman S., Hunt S., Barrell B.G., Skelton J., Brown D., Rice P., Odell C., Whitehead S., Badcock K., Chillingworth T., Churcher C.M., Dedman K., Devlin K., Hamlin N., Jagels K., Lye G., Moule S., Rajandream M.A., Walsh S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "reference": [ { "type": "PubMed", "id": "9169872", "url": "https://glygen.org/publication/PubMed/9169872" } ] } ], "pathway": [ { "id": "sce:YMR188C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YMR188C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrial small ribosomal subunit", "id": "GO:0005763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005763", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "rRNA binding", "id": "GO:0019843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019843", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" }, { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mitochondrial translation", "id": "GO:0032543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032543", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" }, { "name": "sporulation resulting in formation of a cellular spore", "id": "GO:0030435", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030435", "evidence": [ { "database": "UniProtKB", "id": "Q03246", "url": "https://www.uniprot.org/uniprot/Q03246" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }