{ "uniprot_canonical_ac": "Q03193-1", "uniprot_ac": "Q03193", "uniprot_id": "YD090_YEAST", "mass": { "chemical_mass": 34631.0, "monoisotopic_mass": 34631.0 }, "refseq": { "ac": "NP_010375", "name": "Ilt1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010375" }, "gene_names": [ { "name": "ILT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010375", "id": "NP_010375" } ], "protein_names": [ { "name": "Uncharacterized membrane protein YDR090C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q03193" }, { "name": "Ilt1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010375", "id": "NP_010375" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q03193", "locus": {} } ], "crossref": [ { "id": "851664", "url": "https://www.ncbi.nlm.nih.gov/gene/851664", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006603", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006603", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR090C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR090C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WRIRYRK", "url": "https://omabrowser.org/oma/group/WRIRYRK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1352658at2759", "url": "http://www.orthodb.org/?query=1352658at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16201", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16201", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16201:SF37", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16201:SF37", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04193", "url": "http://pfam.xfam.org/family/PF04193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q03193", "url": "http://purl.obolibrary.org/obo/PR_Q03193", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010375", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002497", "url": "https://www.yeastgenome.org/locus/S000002497", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q03193-1", "url": "https://www.uniprot.org/uniprot/Q03193-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MISEKAATALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVILQVQPHLFMFFCSISFVQSCYYPPISMARSKIVMIVAAIIAADVGMEVGFILWLRPLYEKGVKWPDLIFGISASVLLAVGLLPPYFELAKRKGRVIGINFAFLFIDSLGAWLSIISVILGNMDIMGIILYSIVAGMELGIFASHFIWWCRFRFLAKGNTFDEESGQAQKEEPDEKIEQDISKSDRNVTNYNLDNCSIPDDASSFADDFNIYDSTDGGTLSRAQTLHAVHGVVVRTDPDRYSRLSV", "length": 310, "header": "sp|Q03193-1|YD090_YEAST Isoform 1 of Uncharacterized membrane protein YDR090C OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q03193-1" }, "isoforms": [ { "isoform_ac": "Q03193-1", "url": "", "sequence": { "sequence": "MISEKAATALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVILQVQPHLFMFFCSISFVQSCYYPPISMARSKIVMIVAAIIAADVGMEVGFILWLRPLYEKGVKWPDLIFGISASVLLAVGLLPPYFELAKRKGRVIGINFAFLFIDSLGAWLSIISVILGNMDIMGIILYSIVAGMELGIFASHFIWWCRFRFLAKGNTFDEESGQAQKEEPDEKIEQDISKSDRNVTNYNLDNCSIPDDASSFADDFNIYDSTDGGTLSRAQTLHAVHGVVVRTDPDRYSRLSV", "length": 310, "header": "sp|Q03193-1|YD090_YEAST Isoform 1 of Uncharacterized membrane protein YDR090C OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q03193-1" }, "locus": { "chromosome": "IV", "start_pos": 625998, "end_pos": 625069, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR090C_mRNA", "url": "https://www.ensembl.org/id/YDR090C_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR090C", "url": "https://www.ensembl.org/id/YDR090C" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 251, "start_aa": "Asn", "end_pos": 251, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn251", "evidence": [ { "id": "Q03193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03193#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 259, "start_aa": "Asn", "end_pos": 259, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn259", "evidence": [ { "id": "Q03193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03193#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr224" }, { "start_pos": 229, "end_pos": 229, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "SGD", "id": "Q03193", "url": "https://www.yeastgenome.org/locus/Q03193" } ], "site_lbl": "Ser229" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "SGD", "id": "Q03193", "url": "https://www.yeastgenome.org/locus/Q03193" } ], "site_lbl": "Thr289" }, { "start_pos": 309, "end_pos": 309, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" }, { "database": "PubMed", "id": "11875433", "url": "https://glygen.org/publication/PubMed/11875433" }, { "database": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" }, { "database": "SGD", "id": "Q03193", "url": "https://www.yeastgenome.org/locus/Q03193" } ], "site_lbl": "Ser309" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae.", "journal": "Nature biotechnology", "date": "2002-03", "authors": "Ficarro Scott B, McCleland Mark L, Stukenberg P Todd, Burke Daniel J, Ross Mark M, Shabanowitz Jeffrey, Hunt Donald F, White Forest M", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "11875433", "url": "https://glygen.org/publication/PubMed/11875433" } ] }, { "title": "Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kim H., von Heijne G., Melen K.", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "12524434", "url": "https://glygen.org/publication/PubMed/12524434" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "A global topology map of the Saccharomyces cerevisiae membrane proteome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Kim H., von Heijne G., Melen K., Oesterberg M.", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "16847258", "url": "https://glygen.org/publication/PubMed/16847258" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" }, { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" }, { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "The rapamycin-sensitive phosphoproteome reveals that TOR controls protein kinase A toward some but not all substrates.", "journal": "Molecular biology of the cell", "date": "2010-10-01", "authors": "Soulard Alexandre, Cremonesi Alessio, Moes Suzette, Sch\u00fctz Fr\u00e9d\u00e9ric, Jen\u00f6 Paul, Hall Michael N", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "20702584", "url": "https://glygen.org/publication/PubMed/20702584" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "Q03193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03193" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR090C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR090C", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q03193", "url": "https://www.uniprot.org/uniprot/Q03193" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 251, "end_pos": 253, "annotation": "n_glycosylation_sequon" }, { "start_pos": 259, "end_pos": 261, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }