{ "uniprot_canonical_ac": "Q02734-1", "uniprot_ac": "Q02734", "uniprot_id": "SIAT6_RAT", "mass": { "chemical_mass": 42082.0, "monoisotopic_mass": 42082.0 }, "refseq": { "ac": "NP_113885", "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885" }, "gene_names": [ { "name": "St3gal3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q02734", "id": "Q02734" }, { "name": "Siat6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885", "id": "NP_113885" }, { "name": "Siat6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q02734", "id": "Q02734" }, { "name": "St3gal3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885", "id": "NP_113885" } ], "protein_names": [ { "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q02734" }, { "name": "2.4.3.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "Alpha 2,3-ST 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "Beta-galactoside alpha-2,3-sialyltransferase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006238777", "id": "XP_006238777" }, { "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006238778", "id": "XP_006238778" }, { "name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885", "id": "NP_113885" }, { "name": "Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "N-acetyllacosaminide alpha 2,3-sialyltransferase; ST3N; ST3GalIII; N-acetyllactosaminide alpha-2,3-sialyltransferase; gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; ST3Gal III; alpha 2,3-ST 3; beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase (N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 6(N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885", "id": "NP_113885" }, { "name": "N-acetyllactosaminide alpha-2,3-sialyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "ST3Gal III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "ST3GalIII", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "ST3N", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" }, { "name": "Sialyltransferase 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02734" } ], "function": [ { "annotation": "Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734#function" }, { "database": "UniProtKB", "id": "P97325", "url": "https://www.uniprot.org/uniprot/P97325#function" } ] }, { "annotation": "St3gal3 modulates pancreatic cancer cell motility and adhesion and enhances metastatic potential. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_113885", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885" }, { "database": "PubMed", "id": "20824144", "url": "https://glygen.org/publication/PubMed/20824144" } ] } ], "disease": [ { "disease_id": "DOID:0080414", "recommended_name": { "id": "DOID:0080414", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080414", "name": "developmental and epileptic encephalopathy 15", "description": "A developmental and epileptic encephalopathy that has_material_basis_in homozygous or compound heterozygous mutation in the ST3GAL3 gene on chromosome 1p34." }, "synonyms": [ { "id": "DOID:0080414", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080414", "name": "early infantile epileptic encephalopathy 15", "description": "" }, { "id": "DOID:0080414", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080414", "name": "DEE15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "developmental and epileptic encephalopathy, 15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "DEE15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "EIEE15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "developmental and epileptic encephalopathy 15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "epileptic encephalopathy, early infantile, 15", "description": "" }, { "id": "MONDO:0014003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014003", "name": "epileptic encephalopathy, early infantile, type 15", "description": "" }, { "id": "MIM:615006", "resource": "MIM", "url": "https://www.omim.org/entry/615006", "name": "Developmental and epileptic encephalopathy 15", "description": "Developmental and epileptic encephalopathy 15" } ], "evidence": [ { "id": "0080414", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080414" } ] }, { "disease_id": "DOID:0081180", "recommended_name": { "id": "DOID:0081180", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081180", "name": "autosomal recessive intellectual developmental disorder 12", "description": "An autosomal recessive intellectual developmental disorder that has_material_basis_in homozygous mutation in the ST3GAL3 gene on chromosome 1p34." }, "synonyms": [ { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "intellectual disability, autosomal recessive 12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "intellectual developmental disorder, autosomal recessive 12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "intellectual disability, autosomal recessive 12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "intellectual disability, autosomal recessive type 12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "mental retardation, autosomal recessive type 12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "MRT12", "description": "" }, { "id": "MONDO:0012612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012612", "name": "mental retardation, autosomal recessive 12", "description": "" }, { "id": "MIM:611090", "resource": "MIM", "url": "https://www.omim.org/entry/611090", "name": "Intellectual developmental disorder, autosomal recessive 12", "description": "Intellectual developmental disorder, autosomal recessive 12" } ], "evidence": [ { "id": "0081180", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081180" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "common_name": "Rat" } ], "gene": [ { "name": "St3gal3", "url": "https://www.uniprot.org/uniprot/Q02734", "locus": { "chromosome": "5", "start_pos": 131470348, "end_pos": 131670810, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019843", "url": "https://www.ensembl.org/id/ENSRNOG00000019843" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019843", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019843", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.4.99.6", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.99.6&UniProtAcc=Q02734", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT29", "url": "http://www.cazy.org/GT29.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3211", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3211", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "64445", "url": "https://www.ncbi.nlm.nih.gov/gene/64445", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:64445", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64445", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WEDSNSM", "url": "https://omabrowser.org/oma/group/WEDSNSM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5404317at2759", "url": "http://www.orthodb.org/?query=5404317at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13713", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13713", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13713:SF37", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13713:SF37", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00777", "url": "http://pfam.xfam.org/family/PF00777", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q02734", "url": "http://purl.obolibrary.org/obo/PR_Q02734", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-4085001", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9037629", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9037629", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-977068", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-977068", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_113885", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "68414", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=68414", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "52316", "url": "https://www.rhea-db.org/rhea/52316", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6A473", "url": "https://www.uniprot.org/uniprot/A0A8I6A473", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A473-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A473-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GDQ1", "url": "https://www.uniprot.org/uniprot/A0A8I6GDQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GDQ1-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GDQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM32", "url": "https://www.uniprot.org/uniprot/F1LM32", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1LM32-1", "url": "https://www.uniprot.org/uniprot/F1LM32-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q02734-1", "url": "https://www.uniprot.org/uniprot/Q02734-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALDGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 374, "header": "sp|Q02734-1|SIAT6_RAT Isoform 1 of CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1 CANONICAL=Q02734-1" }, "isoforms": [ { "isoform_ac": "A0A8I6A473-1", "url": "", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTGTNPPPLSLLEPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 370, "header": "tr|A0A8I6A473-1|SIAT6_RAT Computationally mapped isoform of CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1 CANONICAL=Q02734-1" }, "locus": { "chromosome": "5", "start_pos": 131645517, "end_pos": 131471250, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000097514.1", "url": "https://www.ensembl.org/id/ENSRNOT00000097514.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086704.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086704.1" } ] } }, { "isoform_ac": "A0A8I6GDQ1-1", "url": "", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSKYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 358, "header": "tr|A0A8I6GDQ1-1|SIAT6_RAT Computationally mapped isoform of CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1 CANONICAL=Q02734-1" }, "locus": { "chromosome": "5", "start_pos": 131645517, "end_pos": 131471250, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000106433.1", "url": "https://www.ensembl.org/id/ENSRNOT00000106433.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086133.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086133.1" } ] } }, { "isoform_ac": "F1LM32-1", "url": "", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 374, "header": "tr|F1LM32-1|SIAT6_RAT Computationally mapped isoform of CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=2 CANONICAL=Q02734-1" }, "locus": { "chromosome": "5", "start_pos": 131645517, "end_pos": 131471250, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000056842.2", "url": "https://www.ensembl.org/id/ENSRNOT00000056842.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000053685.2", "url": "https://www.ensembl.org/id/ENSRNOP00000053685.2" } ] } }, { "isoform_ac": "Q02734-1", "url": "", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALDGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 374, "header": "sp|Q02734-1|SIAT6_RAT Isoform 1 of CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1 CANONICAL=Q02734-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 170, "start_aa": "Asn", "end_pos": 170, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn170", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Primary structure of Gal beta 1,3(4)GlcNAc alpha 2,3-sialyltransferase determined by mass spectrometry sequence analysis and molecular cloning. Evidence for a protein motif in the sialyltransferase gene family.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Wen DX, Livingston BD, Medzihradszky KF, Kelm S, Burlingame AL, Paulson JC", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "reference": [ { "type": "PubMed", "id": "1400416", "url": "https://glygen.org/publication/PubMed/1400416" } ] }, { "title": "alpha2,3-sialyltransferase ST3Gal III modulates pancreatic cancer cell motility and adhesion in vitro and enhances its metastatic potential in vivo.", "journal": "PloS one", "date": "2010", "authors": "Perez-Garay M, Arteta B, Pages L, de Llorens R, de Bolos C, Vidal-Vanaclocha F, Peracaula R", "evidence": [ { "database": "RefSeq", "id": "NP_113885", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113885" } ], "reference": [ { "type": "PubMed", "id": "20824144", "url": "https://glygen.org/publication/PubMed/20824144" } ] } ], "pathway": [ { "id": "rno:64445", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64445", "resource": "KEGG Pathway" }, { "id": "R-RNO-2022854", "name": "Keratan sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022854", "resource": "Reactome", "description": "Keratan sulfate biosynthesis" }, { "id": "R-RNO-4085001", "name": "Sialic acid metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "resource": "Reactome", "description": "Sialic acid metabolism" }, { "id": "R-RNO-9037629", "name": "Lewis blood group biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9037629", "resource": "Reactome", "description": "Lewis blood group biosynthesis" }, { "id": "R-RNO-977068", "name": "Termination of O-glycan biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-977068", "resource": "Reactome", "description": "Termination of O-glycan biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P97325-1", "protein_name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase", "gene_name": "St3gal3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 374 }, "evidence": [ { "id": "45228003", "url": "http://www.informatics.jax.org/homology/45228003", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q11203-1", "protein_name": "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase", "gene_name": "ST3GAL3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI", "length": 375 }, "evidence": [ { "id": "45228003", "url": "http://www.informatics.jax.org/homology/45228003", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "Golgi cisterna membrane", "id": "GO:0032580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein glycosylation", "id": "GO:0006486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "ganglioside biosynthetic process via lactosylceramide", "id": "GO:0010706", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010706", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "sialyltransferase activity", "id": "GO:0008373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008373", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "beta-galactoside (CMP) alpha-2,3-sialyltransferase activity", "id": "GO:0003836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003836", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" }, { "name": "N-acetyllactosaminide alpha-2,3-sialyltransferase activity", "id": "GO:0008118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008118", "evidence": [ { "database": "UniProtKB", "id": "Q02734", "url": "https://www.uniprot.org/uniprot/Q02734" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "52316", "name": "", "equation": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61131-1", "Q02734-1", "Q11206-1", "Q11203-1", "Q91Y74-1", "P97325-1" ], "evidence": [ { "id": "52316", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52316" } ] }, { "id": "R-RNO-2046285", "name": "The keratan chain can be capped by N-acetylneuraminic acid", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61131-1", "P61943-1", "Q02734-1", "Q11205-1" ], "evidence": [ { "id": "R-RNO-2046285", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2046285" } ] }, { "id": "R-RNO-4084984", "name": "ST3GAL1-6 transfer Neu5Ac to terminal Gal (alpha-2,3 link)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-ALL-4086285" ], "output_participant_list": [ "R-ALL-4086277" ], "enzyme_list": [ "P61131-1", "P61943-1", "Q02734-1", "Q11205-1", "Q68G12-1" ], "evidence": [ { "id": "R-RNO-4084984", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4084984" } ] }, { "id": "R-RNO-9603987", "name": "ST3GAL3 transfers Neu5Ac to Type 1 chain to form Type 1 MSGG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-9605595" ], "enzyme_list": [ "Q02734-1" ], "evidence": [ { "id": "R-RNO-9603987", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9603987" } ] }, { "id": "R-RNO-9605600", "name": "ST3GAL3,4,6 transfer Neu5Ac to Type 2 chain to form Type 2 MSGG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-ALL-9033790" ], "output_participant_list": [ "R-ALL-9605685" ], "enzyme_list": [ "P61131-1", "P61943-1", "Q02734-1" ], "evidence": [ { "id": "R-RNO-9605600", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9605600" } ] }, { "id": "R-RNO-981497", "name": "ST3GAL1-4 transfers sialic acid to the T antigen at the alpha 3 position", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61131-1", "Q02734-1", "Q11205-1" ], "evidence": [ { "id": "R-RNO-981497", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-981497" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-4086277", "participant_name": "Neu5Ac-2,3-Gal-R [Golgi lumen]", "crossref": [ { "id": "75127", "database": "ChEBI", "url": "" }, { "id": "75127", "database": "ChEBI", "url": "" }, { "id": "75127", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-4086285", "participant_name": "Gal-R [Golgi lumen]", "crossref": [ { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9033790", "participant_name": "Type 2 chain [Golgi lumen]", "crossref": [ { "id": "139350", "database": "ChEBI", "url": "" }, { "id": "139350", "database": "ChEBI", "url": "" }, { "id": "139350", "database": "ChEBI", "url": "" }, { "id": "139350", "database": "ChEBI", "url": "" }, { "id": "139350", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9605595", "participant_name": "Type 1 MSGG [Golgi lumen]", "crossref": [ { "id": "140917", "database": "ChEBI", "url": "" }, { "id": "140917", "database": "ChEBI", "url": "" }, { "id": "140917", "database": "ChEBI", "url": "" }, { "id": "140917", "database": "ChEBI", "url": "" }, { "id": "140917", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9605685", "participant_name": "Type 2 MSGG [Golgi lumen]", "crossref": [ { "id": "140918", "database": "ChEBI", "url": "" }, { "id": "140918", "database": "ChEBI", "url": "" }, { "id": "140918", "database": "ChEBI", "url": "" }, { "id": "140918", "database": "ChEBI", "url": "" }, { "id": "140918", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P61131", "gene_name": "St3gal4", "activity": [ { "ec_number": "3.6.1.59", "activity": "a 5'-end (N(2),N(2),N(7)-trimethyl 5'-triphosphoguanosine)-(ribonucleoside) in mRNA + H2O = (N(2),N(2),N(7))-trimethyl-GMP + a 5'-end diphospho-ribonucleoside in mRNA + 2 H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "3.6.1.59", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.2", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] } ] }, { "uniprot_ac": "P61943", "gene_name": "St3gal6", "activity": [ { "ec_number": "2.4.99.-", "activity": "", "evidence": [ { "id": "P61943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61943" } ] } ] }, { "uniprot_ac": "P97325", "gene_name": "St3gal3", "activity": [ { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "P97325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97325" } ] }, { "ec_number": "2.4.3.6", "activity": "", "evidence": [ { "id": "P97325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97325" } ] } ] }, { "uniprot_ac": "Q02734", "gene_name": "St3gal3", "activity": [ { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734" } ] }, { "ec_number": "2.4.3.6", "activity": "", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734" } ] } ] }, { "uniprot_ac": "Q11203", "gene_name": "ST3GAL3", "activity": [ { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q11203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11203" } ] }, { "ec_number": "2.4.3.6", "activity": "", "evidence": [ { "id": "Q11203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11203" } ] } ] }, { "uniprot_ac": "Q11205", "gene_name": "St3gal2", "activity": [ { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] } ] }, { "uniprot_ac": "Q11206", "gene_name": "ST3GAL4", "activity": [ { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q11206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11206" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q11206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11206" } ] }, { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q11206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11206" } ] }, { "ec_number": "2.4.3.2", "activity": "", "evidence": [ { "id": "Q11206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11206" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "Q11206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11206" } ] } ] }, { "uniprot_ac": "Q68G12", "gene_name": "St3gal5", "activity": [ { "ec_number": "2.4.3.9", "activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12" } ] }, { "ec_number": "2.4.3.9", "activity": "", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12" } ] } ] }, { "uniprot_ac": "Q91Y74", "gene_name": "St3gal4", "activity": [ { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q91Y74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y74" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q91Y74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y74" } ] }, { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q91Y74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y74" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "Q91Y74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y74" } ] }, { "ec_number": "2.4.3.2", "activity": "", "evidence": [ { "id": "Q91Y74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y74" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }