{ "uniprot_canonical_ac": "Q02647-1", "uniprot_ac": "Q02647", "uniprot_id": "DYL1_YEAST", "mass": { "chemical_mass": 10441.0, "monoisotopic_mass": 10441.0 }, "refseq": { "ac": "NP_010712", "name": "dynein light chain", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010712" }, "gene_names": [ { "name": "DYN2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q02647", "id": "Q02647" }, { "name": "DYN2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010712", "id": "NP_010712" }, { "name": "SLC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010712", "id": "NP_010712" }, { "name": "SLC1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q02647", "id": "Q02647" } ], "protein_names": [ { "name": "Dynein light chain 1, cytoplasmic", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q02647" }, { "name": "dynein light chain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010712", "id": "NP_010712" } ], "function": [ { "annotation": "Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity). Also a component of the nuclear pore complex where it may contribute to the stable association of the Nup82 subcomplex with the NPC (PubMed:17546040, PubMed:23223634, PubMed:25646085).", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647#function" }, { "database": "PubMed", "id": "23223634", "url": "https://glygen.org/publication/PubMed/23223634" }, { "database": "PubMed", "id": "17546040", "url": "https://glygen.org/publication/PubMed/17546040" }, { "database": "PubMed", "id": "25646085", "url": "https://glygen.org/publication/PubMed/25646085" } ] } ], "disease": [ { "disease_id": "DOID:0060319", "recommended_name": { "id": "DOID:0060319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060319", "name": "cardiac arrest", "description": "A congestive heart failure characterized by a sudden stop in effective blood circulation due to the failure of the heart to contract effectively or at all." }, "synonyms": [ { "id": "DOID:0060319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060319", "name": "cardiopulmonary arrest", "description": "" }, { "id": "DOID:0060319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060319", "name": "circulatory arrest", "description": "" } ], "evidence": [ { "id": "0060319", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060319" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:1875", "recommended_name": { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "impotence", "description": "A sexual dysfunction that is characterized by persistent or recurrent inability to achieve or to maintain an erection during sexual activity." }, "synonyms": [ { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "Sexual impotence", "description": "" }, { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "erectile dysfunction", "description": "" } ], "evidence": [ { "id": "1875", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1875" } ] }, { "disease_id": "DOID:3525", "recommended_name": { "id": "DOID:3525", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3525", "name": "middle cerebral artery infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "3525", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3525" } ] }, { "disease_id": "DOID:6000", "recommended_name": { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "congestive heart failure", "description": "A heart disease that is characterized by any structural or functional cardiac disorder that impairs the ability of the heart to fill with or pump a sufficient amount of blood throughout the body." }, "synonyms": [ { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "CHF", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Cardiac Failure Congestive", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Congestive heart disease", "description": "" }, { "id": "DOID:6000", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6000", "name": "Weak heart", "description": "" } ], "evidence": [ { "id": "6000", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6000" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "common_name": "Yeast" } ], "gene": [ { "name": "DYN2", "url": "https://www.uniprot.org/uniprot/Q02647", "locus": { "chromosome": "IV", "start_pos": 1319387, "end_pos": 1319841, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YDR424C", "url": "https://www.ensembl.org/id/YDR424C" } ] } } ], "crossref": [ { "id": "cd21452", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21452", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "852034", "url": "https://www.ncbi.nlm.nih.gov/gene/852034", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q02647", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q02647*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001372", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001372", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019763", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019763", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037177", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037177", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR424C", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR424C", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "THEKGHF", "url": "https://omabrowser.org/oma/group/THEKGHF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4950605at2759", "url": "http://www.orthodb.org/?query=4950605at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11886", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11886", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11886:SF35", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11886:SF35", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4DS1", "url": "https://www.rcsb.org/structure/4DS1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HT6", "url": "https://www.rcsb.org/structure/4HT6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7N9F", "url": "https://www.rcsb.org/structure/7N9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01221", "url": "http://pfam.xfam.org/family/PF01221", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q02647", "url": "http://purl.obolibrary.org/obo/PR_Q02647", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010712", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010712", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002832", "url": "https://www.yeastgenome.org/locus/S000002832", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q02647-1", "url": "https://www.uniprot.org/uniprot/Q02647-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA", "length": 92, "header": "sp|Q02647-1|DYL1_YEAST Isoform 1 of Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae S288C OX=559292 GN=DYN2 PE=1 SV=1 CANONICAL=Q02647-1" }, "isoforms": [ { "isoform_ac": "Q02647-1", "url": "", "sequence": { "sequence": "MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA", "length": 92, "header": "sp|Q02647-1|DYL1_YEAST Isoform 1 of Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae S288C OX=559292 GN=DYN2 PE=1 SV=1 CANONICAL=Q02647-1" }, "locus": { "chromosome": "IV", "start_pos": 1319841, "end_pos": 1319390, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR424C_mRNA", "url": "https://www.ensembl.org/id/YDR424C_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR424C", "url": "https://www.ensembl.org/id/YDR424C" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Molecular basis for the functional interaction of dynein light chain with the nuclear-pore complex.", "journal": "Nat. Cell Biol.", "date": "2007", "authors": "Boettcher B., Kunze R., Hurt E., Philippsen P., Hoepfner D., Flemming D., Diepholz M., Stelter P.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "17546040", "url": "https://glygen.org/publication/PubMed/17546040" } ] }, { "title": "Multiple recognition motifs in nucleoporin Nup159 provide a stable and rigid Nup159-Dyn2 assembly.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Song Y., Zidek L., Barbar E., Nyarko A., Novacek J.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "23223634", "url": "https://glygen.org/publication/PubMed/23223634" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Structural basis for assembly and function of the Nup82 complex in the nuclear pore scaffold.", "journal": "J. Cell Biol.", "date": "2015", "authors": "Fischer J., Beck M., Hurt E., Muecke N., Barbar E., Flemming D., von Appen A., Gaik M., Bassler J., Bui K.H., Kastritis P., Ori A., Stelter P.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "25646085", "url": "https://glygen.org/publication/PubMed/25646085" } ] }, { "title": "Molecular and genetic characterization of SLC1, a putative Saccharomyces cerevisiae homolog of the metazoan cytoplasmic dynein light chain 1.", "journal": "Mol. Gen. Genet.", "date": "1996", "authors": "Chia W., Dick T., Surana U.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "8628245", "url": "https://glygen.org/publication/PubMed/8628245" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR424C", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR424C", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O96860-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "Cdlc2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG", "length": 89 }, "evidence": [ { "id": "Q02647", "url": "https://omabrowser.org/oma/group/Q02647/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q78P75-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "Dynll2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG", "length": 89 }, "evidence": [ { "id": "Q02647", "url": "https://omabrowser.org/oma/group/Q02647/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG", "length": 89 }, "evidence": [ { "id": "Q02647", "url": "https://omabrowser.org/oma/group/Q02647/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D0M5-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "Dynll2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG", "length": 89 }, "evidence": [ { "id": "Q02647", "url": "https://omabrowser.org/oma/group/Q02647/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "peroxisomal importomer complex", "id": "GO:1990429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990429", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "nuclear pore", "id": "GO:0005643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005643", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "cytoplasmic microtubule", "id": "GO:0005881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005881", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "nuclear periphery", "id": "GO:0034399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034399", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "cytoplasmic dynein complex", "id": "GO:0005868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005868", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "nucleocytoplasmic transport", "id": "GO:0006913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006913", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "establishment of mitotic spindle orientation", "id": "GO:0000132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000132", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "establishment of mitotic spindle localization", "id": "GO:0040001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040001", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "nuclear pore complex assembly", "id": "GO:0051292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051292", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "mRNA transport", "id": "GO:0051028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051028", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "nuclear migration along microtubule", "id": "GO:0030473", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030473", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" }, { "name": "dynein intermediate chain binding", "id": "GO:0045505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045505", "evidence": [ { "database": "UniProtKB", "id": "Q02647", "url": "https://www.uniprot.org/uniprot/Q02647" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }