{ "uniprot_canonical_ac": "Q02363-1", "uniprot_ac": "Q02363", "uniprot_id": "ID2_HUMAN", "mass": { "chemical_mass": 14917.0, "monoisotopic_mass": 14917.0 }, "refseq": { "ac": "NP_002157", "name": "DNA-binding protein inhibitor ID-2", "summary": "The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" }, "gene_names": [ { "name": "ID2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q02363", "id": "Q02363" }, { "name": "BHLHB26", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q02363", "id": "Q02363" }, { "name": "ID2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157", "id": "NP_002157" }, { "name": "bHLHb26; GIG8; ID2A; ID2H", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157", "id": "NP_002157" } ], "protein_names": [ { "name": "DNA-binding protein inhibitor ID-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q02363" }, { "name": "Class B basic helix-loop-helix protein 26", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02363" }, { "name": "DNA-binding protein inhibitor ID-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157", "id": "NP_002157" }, { "name": "Inhibitor of DNA binding 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02363" }, { "name": "Inhibitor of differentiation 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02363" }, { "name": "bHLHb26", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q02363" }, { "name": "inhibitor of differentiation 2; DNA-binding protein inhibitor ID2; helix-loop-helix protein ID2; cell growth-inhibiting gene 8; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; class B basic helix-loop-helix protein 26; inhibitor of DNA binding 2, HLH protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157", "id": "NP_002157" } ], "function": [ { "annotation": "GDF-11 promotes human trophoblast cell invasion by increasing ID2-mediated MMP2 expression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" }, { "database": "PubMed", "id": "35705978", "url": "https://glygen.org/publication/PubMed/35705978" } ] }, { "annotation": "ID proteins promote the survival and primed-to-naive transition of human embryonic stem cells through TCF3-mediated transcription. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" }, { "database": "PubMed", "id": "35701409", "url": "https://glygen.org/publication/PubMed/35701409" } ] }, { "annotation": "SMURF2 facilitates ubiquitin-mediated degradation of ID2 to attenuate lung cancer cell proliferation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" }, { "database": "PubMed", "id": "37497010", "url": "https://glygen.org/publication/PubMed/37497010" } ] }, { "annotation": "Temporal Expression of Transcription Factor ID2 Improves Natural Killer Cell Differentiation from Human Pluripotent Stem Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" }, { "database": "PubMed", "id": "35608547", "url": "https://glygen.org/publication/PubMed/35608547" } ] }, { "annotation": "The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" } ] }, { "annotation": "Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer. Restricts the CLOCK and BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363#function" }, { "database": "PubMed", "id": "20861012", "url": "https://glygen.org/publication/PubMed/20861012" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "92.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "96.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q02363", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q02363" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "common_name": "Human" } ], "gene": [ { "name": "ID2", "url": "https://www.uniprot.org/uniprot/Q02363", "locus": { "chromosome": "2", "start_pos": 8684461, "end_pos": 8678845, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000115738", "url": "https://www.ensembl.org/id/ENSG00000115738" } ] } } ], "crossref": [ { "id": "ENSG00000115738", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115738", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19692", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19692", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "ID2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ID2", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "3398", "url": "https://www.ncbi.nlm.nih.gov/gene/3398", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5361", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5361", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q02363", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q02363*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026052", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026052", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3398", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3398", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600386", "url": "http://www.omim.org/entry/600386", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q02363", "url": "https://www.nextprot.org/entry/NX_Q02363", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q02363", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02363", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TPEFQSD", "url": "https://omabrowser.org/oma/group/TPEFQSD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4207391at2759", "url": "http://www.orthodb.org/?query=4207391at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11723", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11723", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11723:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11723:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4AYA", "url": "https://www.rcsb.org/structure/4AYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q02363", "url": "https://pharos.nih.gov/targets/Q02363", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q02363", "url": "http://purl.obolibrary.org/obo/PR_Q02363", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q02363-1", "url": "https://www.uniprot.org/uniprot/Q02363-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG", "length": 134, "header": "sp|Q02363-1|ID2_HUMAN Isoform 1 of DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1 CANONICAL=Q02363-1" }, "isoforms": [ { "isoform_ac": "Q02363-1", "url": "", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG", "length": 134, "header": "sp|Q02363-1|ID2_HUMAN Isoform 1 of DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1 CANONICAL=Q02363-1" }, "locus": { "chromosome": "2", "start_pos": 8682896, "end_pos": 8682166, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396290.2", "url": "https://www.ensembl.org/id/ENST00000396290.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000379585.1", "url": "https://www.ensembl.org/id/ENSP00000379585.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q02363", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02363" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "site_lbl": "Ser14" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "site_lbl": "Ser25" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" }, { "database": "PubMed", "id": "26735018", "url": "https://glygen.org/publication/PubMed/26735018" } ], "site_lbl": "Thr27" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" }, { "database": "PubMed", "id": "9029153", "url": "https://glygen.org/publication/PubMed/9029153" }, { "database": "phospho.ELM", "id": "Q02363", "url": "http://phospho.elm.eu.org/byAccession/Q02363.html" } ], "site_lbl": "Ser5" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" }, { "database": "PubMed", "id": "9029153", "url": "https://glygen.org/publication/PubMed/9029153" }, { "database": "PRO", "id": "Q02363", "url": "http://purl.obolibrary.org/obo/Q02363" }, { "database": "PubMed", "id": "26110849", "url": "https://glygen.org/publication/PubMed/26110849" }, { "database": "PubMed", "id": "9372912", "url": "https://glygen.org/publication/PubMed/9372912" } ], "site_lbl": "Ser5" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The EGR family of transcription-regulatory factors: progress at the interface of molecular and systems neuroscience.", "journal": "Trends in neurosciences", "date": "1999", "authors": "O'Donovan KJ, Tourtellotte WG, Millbrandt J, Baraban JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10203854", "url": "https://glygen.org/publication/PubMed/10203854" } ] }, { "title": "Staurosporine enhances cAMP-induced expression of neural-specific gene VGF and tyrosine hydroxylase.", "journal": "Neuroscience letters", "date": "1999", "authors": "Nagasaki K, Sasaki K, Maass N, Tsukada T, Hanzawa H, Yamaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10381005", "url": "https://glygen.org/publication/PubMed/10381005" } ] }, { "title": "Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain.", "journal": "Exp. Cell Res.", "date": "1999", "authors": "Law SF, Zhang YZ, Fashena SJ, Toby G, Estojak J, Golemis EA", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "reference": [ { "type": "PubMed", "id": "10502414", "url": "https://glygen.org/publication/PubMed/10502414" } ] }, { "title": "Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Massari ME, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611221", "url": "https://glygen.org/publication/PubMed/10611221" } ] }, { "title": "Interaction of the Ras-related protein associated with diabetes rad and the putative tumor metastasis suppressor NM23 provides a novel mechanism of GTPase regulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Zhu J, Tseng YH, Kantor JD, Rhodes CJ, Zetter BR, Moyers JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10611312", "url": "https://glygen.org/publication/PubMed/10611312" } ] }, { "title": "Reciprocal Id expression and myelin gene regulation in Schwann cells.", "journal": "Molecular and cellular neurosciences", "date": "1999", "authors": "Thatikunta P, Qin W, Christy BA, Tennekoon GI, Rutkowski JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10656257", "url": "https://glygen.org/publication/PubMed/10656257" } ] }, { "title": "A novel activation function for NAB proteins in EGR-dependent transcription of the luteinizing hormone beta gene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sevetson BR, Svaren J, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10734128", "url": "https://glygen.org/publication/PubMed/10734128" } ] }, { "title": "Full promoter sequence of human early growth response factor-1 (Egr-1): demonstration of a fifth functional serum response element.", "journal": "DNA sequence : the journal of DNA sequencing and mapping", "date": "2000", "authors": "Schwachtgen JL, Campbell CJ, Braddock M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10826704", "url": "https://glygen.org/publication/PubMed/10826704" } ] }, { "title": "CREB: a stimulus-induced transcription factor activated by a diverse array of extracellular signals.", "journal": "Annual review of biochemistry", "date": "1999", "authors": "Shaywitz AJ, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10872467", "url": "https://glygen.org/publication/PubMed/10872467" } ] }, { "title": "VGF: a novel role for this neuronal and neuroendocrine polypeptide in the regulation of energy balance.", "journal": "Frontiers in neuroendocrinology", "date": "2000", "authors": "Salton SR, Ferri GL, Hahm S, Snyder SE, Wilson AJ, Possenti R, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10882540", "url": "https://glygen.org/publication/PubMed/10882540" } ] }, { "title": "EGR1 target genes in prostate carcinoma cells identified by microarray analysis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Svaren J, Ehrig T, Abdulkadir SA, Ehrengruber MU, Watson MA, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "10984481", "url": "https://glygen.org/publication/PubMed/10984481" } ] }, { "title": "The human transcriptional repressor protein NAB1: expression and biological activity.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Thiel G, Kaufmann K, Magin A, Lietz M, Bach K, Cramer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11018254", "url": "https://glygen.org/publication/PubMed/11018254" } ] }, { "title": "Regulation of Id gene expression during embryonic stem cell-derived hematopoietic differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Nogueira MM, Mitjavila-Garcia MT, Le Pesteur F, Filippi MD, Vainchenker W, Dubart Kupperschmitt A, Sainteny F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11027551", "url": "https://glygen.org/publication/PubMed/11027551" } ] }, { "title": "Regulation of growth and tumorigenicity of breast cancer cells by the low molecular weight GTPase Rad and nm23.", "journal": "Cancer research", "date": "2001", "authors": "Tseng YH, Vicent D, Zhu J, Niu Y, Adeyinka A, Moyers JS, Watson PH, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11280768", "url": "https://glygen.org/publication/PubMed/11280768" } ] }, { "title": "ERK induces p35, a neuron-specific activator of Cdk5, through induction of Egr1.", "journal": "Nature cell biology", "date": "2001", "authors": "Harada T, Morooka T, Ogawa S, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11331872", "url": "https://glygen.org/publication/PubMed/11331872" } ] }, { "title": "Selective targeting of newly synthesized Arc mRNA to active synapses requires NMDA receptor activation.", "journal": "Neuron", "date": "2001", "authors": "Steward O, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11343657", "url": "https://glygen.org/publication/PubMed/11343657" } ] }, { "title": "Frequent and early loss of the EGR1 corepressor NAB2 in human prostate carcinoma.", "journal": "Human pathology", "date": "2001", "authors": "Abdulkadir SA, Carbone JM, Naughton CK, Humphrey PA, Catalona WJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11567222", "url": "https://glygen.org/publication/PubMed/11567222" } ] }, { "title": "NGF-dependent and tissue-specific transcription of vgf is regulated by a CREB-p300 and bHLH factor interaction.", "journal": "FEBS letters", "date": "2002", "authors": "Mandolesi G, Gargano S, Pennuto M, Illi B, Molfetta R, Soucek L, Mosca L, Levi A, Jucker R, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11755530", "url": "https://glygen.org/publication/PubMed/11755530" } ] }, { "title": "The regulation and function of the Id proteins in lymphocyte development.", "journal": "Oncogene", "date": "2001", "authors": "Rivera R, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11840323", "url": "https://glygen.org/publication/PubMed/11840323" } ] }, { "title": "The GTP binding proteins Gem and Rad are negative regulators of the Rho-Rho kinase pathway.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ward Y, Yap SF, Ravichandran V, Matsumura F, Ito M, Spinelli B, Kelly K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "11956230", "url": "https://glygen.org/publication/PubMed/11956230" } ] }, { "title": "Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Lunyak VV, Burgess R, Prefontaine GG, Nelson C, Sze SH, Chenoweth J, Schwartz P, Pevzner PA, Glass C, Mandel G, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12399542", "url": "https://glygen.org/publication/PubMed/12399542" } ] }, { "title": "Synthesis of serotonin by a second tryptophan hydroxylase isoform.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Walther DJ, Peter JU, Bashammakh S, Hortnagl H, Voits M, Fink H, Bader M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "12511643", "url": "https://glygen.org/publication/PubMed/12511643" } ] }, { "title": "NGF induces the expression of the VGF gene through a cAMP response element.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1992", "authors": "Hawley RJ, Scheibe RJ, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1377233", "url": "https://glygen.org/publication/PubMed/1377233" } ] }, { "title": "Local regulation of fat metabolism in peripheral nerves.", "journal": "Genes & development", "date": "2003", "authors": "Verheijen MH, Chrast R, Burrola P, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14522948", "url": "https://glygen.org/publication/PubMed/14522948" } ] }, { "title": "Disruption of the nonneuronal tph1 gene demonstrates the importance of peripheral serotonin in cardiac function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Cote F, Thevenot E, Fligny C, Fromes Y, Darmon M, Ripoche MA, Bayard E, Hanoun N, Saurini F, Lechat P, Dandolo L, Hamon M, Mallet J, Vodjdani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14597720", "url": "https://glygen.org/publication/PubMed/14597720" } ] }, { "title": "Orphan nuclear receptor small heterodimer partner, a novel corepressor for a basic helix-loop-helix transcription factor BETA2/neuroD.", "journal": "Mol. Endocrinol.", "date": "2004", "authors": "Takeda J., Shong M., Kim J.Y., Tsai M.J., Kim H.J., Choi H.S., Park K.C., Sanyal S., Ha H., Chu K., Seong H.A.", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "reference": [ { "type": "PubMed", "id": "14752053", "url": "https://glygen.org/publication/PubMed/14752053" } ] }, { "title": "Muscarinic acetylcholine receptor stimulation induces expression of the activity-regulated cytoskeleton-associated gene (ARC).", "journal": "Brain research. Molecular brain research", "date": "2004", "authors": "Teber I, Kohling R, Speckmann EJ, Barnekow A, Kremerskothen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "14969744", "url": "https://glygen.org/publication/PubMed/14969744" } ] }, { "title": "Rho kinase regulates schwann cell myelination and formation of associated axonal domains.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Melendez-Vasquez CV, Einheber S, Salzer JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15102911", "url": "https://glygen.org/publication/PubMed/15102911" } ] }, { "title": "Neurotrophins regulate Schwann cell migration by activating divergent signaling pathways dependent on Rho GTPases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Yamauchi J, Chan JR, Shooter EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15161978", "url": "https://glygen.org/publication/PubMed/15161978" } ] }, { "title": "Egr-1 is activated by 17beta-estradiol in MCF-7 cells by mitogen-activated protein kinase-dependent phosphorylation of ELK-1.", "journal": "Journal of cellular biochemistry", "date": "2004", "authors": "Chen CC, Lee WR, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15449318", "url": "https://glygen.org/publication/PubMed/15449318" } ] }, { "title": "Ternary complex factor-serum response factor complex-regulated gene activity is required for cellular proliferation and inhibition of apoptotic cell death.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Vickers ER, Kasza A, Kurnaz IA, Seifert A, Zeef LA, O'donnell A, Hayes A, Sharrocks AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15542842", "url": "https://glygen.org/publication/PubMed/15542842" } ] }, { "title": "Defining the CREB regulon: a genome-wide analysis of transcription factor regulatory regions.", "journal": "Cell", "date": "2004", "authors": "Impey S, McCorkle SR, Cha-Molstad H, Dwyer JM, Yochum GS, Boss JM, McWeeney S, Dunn JJ, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15620361", "url": "https://glygen.org/publication/PubMed/15620361" } ] }, { "title": "Regulatory elements in the promoter region of vgf, a nerve growth factor-inducible gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Possenti R, Di Rocco G, Nasi S, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1570299", "url": "https://glygen.org/publication/PubMed/1570299" } ] }, { "title": "Serum/glucocorticoid-inducible kinase can phosphorylate the cyclic AMP response element binding protein, CREB.", "journal": "FEBS letters", "date": "2005", "authors": "David S, Kalb RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15733869", "url": "https://glygen.org/publication/PubMed/15733869" } ] }, { "title": "Regulation of cholesterol/lipid biosynthetic genes by Egr2/Krox20 during peripheral nerve myelination.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Leblanc SE, Srinivasan R, Ferri C, Mager GM, Gillian-Daniel AL, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15836632", "url": "https://glygen.org/publication/PubMed/15836632" } ] }, { "title": "SRF mediates activity-induced gene expression and synaptic plasticity but not neuronal viability.", "journal": "Nature neuroscience", "date": "2005", "authors": "Ramanan N, Shen Y, Sarsfield S, Lemberger T, Schutz G, Linden DJ, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "15880109", "url": "https://glygen.org/publication/PubMed/15880109" } ] }, { "title": "Id family of helix-loop-helix proteins in cancer.", "journal": "Nature reviews. Cancer", "date": "2005", "authors": "Perk J, Iavarone A, Benezra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16034366", "url": "https://glygen.org/publication/PubMed/16034366" } ] }, { "title": "Nab proteins are essential for peripheral nervous system myelination.", "journal": "Nature neuroscience", "date": "2005", "authors": "Le N, Nagarajan R, Wang JY, Svaren J, LaPash C, Araki T, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16136673", "url": "https://glygen.org/publication/PubMed/16136673" } ] }, { "title": "BMP enhances transcriptional responses to NGF during PC12 cell differentiation.", "journal": "Neurochemical research", "date": "2005", "authors": "Lonn P, Zaia K, Israelsson C, Althini S, Usoskin D, Kylberg A, Ebendal T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16187211", "url": "https://glygen.org/publication/PubMed/16187211" } ] }, { "title": "A prohormone convertase cleavage site within a predicted alpha-helix mediates sorting of the neuronal and endocrine polypeptide VGF into the regulated secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Garcia AL, Han SK, Janssen WG, Khaing ZZ, Ito T, Glucksman MJ, Benson DL, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16221685", "url": "https://glygen.org/publication/PubMed/16221685" } ] }, { "title": "Egr-1 induces the expression of its corepressor nab2 by activation of the nab2 promoter thereby establishing a negative feedback loop.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kumbrink J, Gerlinger M, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16260776", "url": "https://glygen.org/publication/PubMed/16260776" } ] }, { "title": "The neuroplasticity-associated arc gene is a direct transcriptional target of early growth response (Egr) transcription factors.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Li L, Carter J, Gao X, Whitehead J, Tourtellotte WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16287845", "url": "https://glygen.org/publication/PubMed/16287845" } ] }, { "title": "Immediate-early gene-encoded protein Arc is associated with synaptic delivery of GluR4-containing AMPA receptors during in vitro classical conditioning.", "journal": "Journal of neurophysiology", "date": "2006", "authors": "Mokin M, Lindahl JS, Keifer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16339507", "url": "https://glygen.org/publication/PubMed/16339507" } ] }, { "title": "Late developmental stage-specific role of tryptophan hydroxylase 1 in brain serotonin levels.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Nakamura K, Sugawara Y, Sawabe K, Ohashi A, Tsurui H, Xiu Y, Ohtsuji M, Lin QS, Nishimura H, Hasegawa H, Hirose S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16407550", "url": "https://glygen.org/publication/PubMed/16407550" } ] }, { "title": "Activity-dependent regulation of MEF2 transcription factors suppresses excitatory synapse number.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Flavell SW, Cowan CW, Kim TK, Greer PL, Lin Y, Paradis S, Griffith EC, Hu LS, Chen C, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16484497", "url": "https://glygen.org/publication/PubMed/16484497" } ] }, { "title": "NAB2 represses transcription by interacting with the CHD4 subunit of the nucleosome remodeling and deacetylase (NuRD) complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Srinivasan R, Mager GM, Ward RM, Mayer J, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16574654", "url": "https://glygen.org/publication/PubMed/16574654" } ] }, { "title": "AMPA receptors regulate transcription of the plasticity-related immediate-early gene Arc.", "journal": "Nature neuroscience", "date": "2006", "authors": "Rao VR, Pintchovski SA, Chin J, Peebles CL, Mitra S, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "16732277", "url": "https://glygen.org/publication/PubMed/16732277" } ] }, { "title": "Arc/Arg3.1 is essential for the consolidation of synaptic plasticity and memories.", "journal": "Neuron", "date": "2006", "authors": "Plath N, Ohana O, Dammermann B, Errington ML, Schmitz D, Gross C, Mao X, Engelsberg A, Mahlke C, Welzl H, Kobalz U, Stawrakakis A, Fernandez E, Waltereit R, Bick-Sander A, Therstappen E, Cooke SF, Blanquet V, Wurst W, Salmen B, Bosl MR, Lipp HP, Grant SG, Bliss TV, Wolfer DP, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088210", "url": "https://glygen.org/publication/PubMed/17088210" } ] }, { "title": "Arc/Arg3.1 interacts with the endocytic machinery to regulate AMPA receptor trafficking.", "journal": "Neuron", "date": "2006", "authors": "Chowdhury S, Shepherd JD, Okuno H, Lyford G, Petralia RS, Plath N, Kuhl D, Huganir RL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088211", "url": "https://glygen.org/publication/PubMed/17088211" } ] }, { "title": "Increased expression of the immediate-early gene arc/arg3.1 reduces AMPA receptor-mediated synaptic transmission.", "journal": "Neuron", "date": "2006", "authors": "Rial Verde EM, Lee-Osbourne J, Worley PF, Malinow R, Cline HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17088212", "url": "https://glygen.org/publication/PubMed/17088212" } ] }, { "title": "A human Id-like helix-loop-helix protein expressed during early development.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Biggs J, Murphy EV, Israel MA", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "reference": [ { "type": "PubMed", "id": "1741406", "url": "https://glygen.org/publication/PubMed/1741406" } ] }, { "title": "The EJC factor eIF4AIII modulates synaptic strength and neuronal protein expression.", "journal": "Cell", "date": "2007", "authors": "Giorgi C, Yeo GW, Stone ME, Katz DB, Burge C, Turrigiano G, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17632064", "url": "https://glygen.org/publication/PubMed/17632064" } ] }, { "title": "Sustained Arc/Arg3.1 synthesis controls long-term potentiation consolidation through regulation of local actin polymerization in the dentate gyrus in vivo.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Messaoudi E, Kanhema T, Soule J, Tiron A, Dagyte G, da Silva B, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "17898216", "url": "https://glygen.org/publication/PubMed/17898216" } ] }, { "title": "Rad GTPase deficiency leads to cardiac hypertrophy.", "journal": "Circulation", "date": "2007", "authors": "Chang L, Zhang J, Tseng YH, Xie CQ, Ilany J, Bruning JC, Sun Z, Zhu X, Cui T, Youker KA, Yang Q, Day SM, Kahn CR, Chen YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18056528", "url": "https://glygen.org/publication/PubMed/18056528" } ] }, { "title": "Serum- and glucocorticoid-inducible kinase 1 enhances zif268 expression through the mediation of SRF and CREB1 associated with spatial memory formation.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Tyan SW, Tsai MC, Lin CL, Ma YL, Lee EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18088355", "url": "https://glygen.org/publication/PubMed/18088355" } ] }, { "title": "Lyl1 interacts with CREB1 and alters expression of CREB1 target genes.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "San-Marina S, Han Y, Suarez Saiz F, Trus MR, Minden MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18160048", "url": "https://glygen.org/publication/PubMed/18160048" } ] }, { "title": "Transactivation of Krox-20 and Krox-24 promoters by the HTLV-1 Tax protein through common regulatory elements.", "journal": "Oncogene", "date": "1991", "authors": "Alexandre C, Charnay P, Verrier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1833716", "url": "https://glygen.org/publication/PubMed/1833716" } ] }, { "title": "Active gene repression by the Egr2.NAB complex during peripheral nerve myelination.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mager GM, Ward RM, Srinivasan R, Jang SW, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18456662", "url": "https://glygen.org/publication/PubMed/18456662" } ] }, { "title": "Disruption of Krox20-Nab interaction in the mouse leads to peripheral neuropathy with biphasic evolution.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2008", "authors": "Desmazieres A, Decker L, Vallat JM, Charnay P, Gilardi-Hebenstreit P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "18524893", "url": "https://glygen.org/publication/PubMed/18524893" } ] }, { "title": "Nucleotide sequence and regulatory studies of VGF, a nervous system-specific mRNA that is rapidly and relatively selectively induced by nerve growth factor.", "journal": "Journal of neurochemistry", "date": "1991", "authors": "Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "1861162", "url": "https://glygen.org/publication/PubMed/1861162" } ] }, { "title": "CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.", "journal": "Molecular cell", "date": "2008", "authors": "Mulligan P, Westbrook TF, Ottinger M, Pavlova N, Chang B, Macia E, Shi YJ, Barretina J, Liu J, Howley PM, Elledge SJ, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19061646", "url": "https://glygen.org/publication/PubMed/19061646" } ] }, { "title": "Synaptic activity-responsive element in the Arc/Arg3.1 promoter essential for synapse-to-nucleus signaling in activated neurons.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Kawashima T, Okuno H, Nonaka M, Adachi-Morishima A, Kyo N, Okamura M, Takemoto-Kimura S, Worley PF, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19116276", "url": "https://glygen.org/publication/PubMed/19116276" } ] }, { "title": "The serum response factor and a putative novel transcription factor regulate expression of the immediate-early gene Arc/Arg3.1 in neurons.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Pintchovski SA, Peebles CL, Kim HJ, Verdin E, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19193899", "url": "https://glygen.org/publication/PubMed/19193899" } ] }, { "title": "Neuroendocrine regulatory peptide-1 and -2: novel bioactive peptides processed from VGF.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Toshinai K, Nakazato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19194657", "url": "https://glygen.org/publication/PubMed/19194657" } ] }, { "title": "Rad as a novel regulator of excitation-contraction coupling and beta-adrenergic signaling in heart.", "journal": "Circulation research", "date": "2010", "authors": "Wang G, Zhu X, Xie W, Han P, Li K, Sun Z, Wang Y, Chen C, Song R, Cao C, Zhang J, Wu C, Liu J, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "19926875", "url": "https://glygen.org/publication/PubMed/19926875" } ] }, { "title": "Structure of the gene encoding VGF, a nervous system-specific mRNA that is rapidly and selectively induced by nerve growth factor in PC12 cells.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Salton SR, Fischberg DJ, Dong KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2017159", "url": "https://glygen.org/publication/PubMed/2017159" } ] }, { "title": "v-Src activates mitogen-responsive transcription factor Egr-1 via serum response elements.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Qureshi SA, Cao XM, Sukhatme VP, Foster DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2040600", "url": "https://glygen.org/publication/PubMed/2040600" } ] }, { "title": "EGR1, EGR2, and EGR3 activate the expression of their coregulator NAB2 establishing a negative feedback loop in cells of neuroectodermal and epithelial origin.", "journal": "Journal of cellular biochemistry", "date": "2010", "authors": "Kumbrink J, Kirsch KH, Johnson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "20506119", "url": "https://glygen.org/publication/PubMed/20506119" } ] }, { "title": "5' upstream sequence and genomic structure of the human primary response gene, EGR-1/TIS8.", "journal": "Oncogene", "date": "1991", "authors": "Sakamoto KM, Bardeleben C, Yates KE, Raines MA, Golde DW, Gasson JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2052361", "url": "https://glygen.org/publication/PubMed/2052361" } ] }, { "title": "The early response gene NGFI-C encodes a zinc finger transcriptional activator and is a member of the GCGGGGGCG (GSG) element-binding protein family.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Crosby SD, Puetz JJ, Simburger KS, Fahrner TJ, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2072895", "url": "https://glygen.org/publication/PubMed/2072895" } ] }, { "title": "The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Duffield G.E., Fernando S.J., Hou T.Y., Ward S.M.", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "reference": [ { "type": "PubMed", "id": "20861012", "url": "https://glygen.org/publication/PubMed/20861012" } ] }, { "title": "Synaptic activity-responsive element (SARE): A unique genomic structure with an unusual sensitivity to neuronal activity.", "journal": "Communicative & integrative biology", "date": "2010", "authors": "Inoue M, Yagishita-Kyo N, Nonaka M, Kawashima T, Okuno H, Bito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21057636", "url": "https://glygen.org/publication/PubMed/21057636" } ] }, { "title": "Identification and characterization of the Egr-1 gene product, a DNA-binding zinc finger protein induced by differentiation and growth signals.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Cao XM, Koski RA, Gashler A, McKiernan M, Morris CF, Gaffney R, Hay RV, Sukhatme VP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2109185", "url": "https://glygen.org/publication/PubMed/2109185" } ] }, { "title": "Activation and function of immediate-early genes in the nervous system.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2011", "authors": "Perez-Cadahia B, Drobic B, Davie JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21326363", "url": "https://glygen.org/publication/PubMed/21326363" } ] }, { "title": "ID1 and ID3 represent conserved negative regulators of human embryonic and induced pluripotent stem cell hematopoiesis.", "journal": "Journal of cell science", "date": "2011", "authors": "Hong SH, Lee JH, Lee JB, Ji J, Bhatia M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21486943", "url": "https://glygen.org/publication/PubMed/21486943" } ] }, { "title": "VGF: an inducible gene product, precursor of a diverse array of neuro-endocrine peptides and tissue-specific disease biomarkers.", "journal": "Journal of chemical neuroanatomy", "date": "2011", "authors": "Ferri GL, Noli B, Brancia C, D'Amato F, Cocco C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "21621608", "url": "https://glygen.org/publication/PubMed/21621608" } ] }, { "title": "Early growth response 1--a transcription factor in the crossfire of signal transduction cascades.", "journal": "Indian journal of biochemistry & biophysics", "date": "2011", "authors": "Pagel JI, Deindl E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22053691", "url": "https://glygen.org/publication/PubMed/22053691" } ] }, { "title": "Global expression analysis identified a preferentially nerve growth factor-induced transcriptional program regulated by sustained mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) and AP-1 protein activation during PC12 cell differentiation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mullenbrock S, Shah J, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22065583", "url": "https://glygen.org/publication/PubMed/22065583" } ] }, { "title": "The nucleosome remodeling and deacetylase chromatin remodeling (NuRD) complex is required for peripheral nerve myelination.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012", "authors": "Hung H, Kohnken R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "22302795", "url": "https://glygen.org/publication/PubMed/22302795" } ] }, { "title": "Localization of human tissue factor antigen by immunostaining with monospecific, polyclonal anti-human tissue factor antibody.", "journal": "Thrombosis research", "date": "1990", "authors": "Fleck RA, Rao LV, Rapaport SI, Varki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2237820", "url": "https://glygen.org/publication/PubMed/2237820" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" }, { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Identification of a functional TPH1 polymorphism associated with irritable bowel syndrome bowel habit subtypes.", "journal": "The American journal of gastroenterology", "date": "2013", "authors": "Grasberger H, Chang L, Shih W, Presson AP, Sayuk GS, Newberry RD, Karagiannides I, Pothoulakis C, Mayer E, Merchant JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "24060757", "url": "https://glygen.org/publication/PubMed/24060757" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" }, { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Id proteins: small molecules, mighty regulators.", "journal": "Current topics in developmental biology", "date": "2014", "authors": "Ling F, Kang B, Sun XH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25248477", "url": "https://glygen.org/publication/PubMed/25248477" } ] }, { "title": "Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.", "journal": "Neuroreport", "date": "2015", "authors": "Moon SM, Kim JS, Park BR, Kim DK, Kim SG, Kim HJ, Chun HS, Lee BK, Kim CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25569790", "url": "https://glygen.org/publication/PubMed/25569790" } ] }, { "title": "Arc is a flexible modular protein capable of reversible self-oligomerization.", "journal": "The Biochemical journal", "date": "2015", "authors": "Myrum C, Baumann A, Bustad HJ, Flydal MI, Mariaule V, Alvira S, Cuellar J, Haavik J, Soule J, Valpuesta JM, Marquez JA, Martinez A, Bramham CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "25748042", "url": "https://glygen.org/publication/PubMed/25748042" } ] }, { "title": "How it all starts: Initiation of the clotting cascade.", "journal": "Critical reviews in biochemistry and molecular biology", "date": "2015", "authors": "Smith SA, Travers RJ, Morrissey JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "26018600", "url": "https://glygen.org/publication/PubMed/26018600" } ] }, { "title": "TNFalpha signaling regulates cystic epithelial cell proliferation through Akt/mTOR and ERK/MAPK/Cdk2 mediated Id2 signaling.", "journal": "PloS one", "date": "2015", "authors": "Zhou JX, Fan LX, Li X, Calvet JP, Li X", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "26110849", "url": "https://glygen.org/publication/PubMed/26110849" } ] }, { "title": "An ID2-dependent mechanism for VHL inactivation in cancer.", "journal": "Nature", "date": "2016", "authors": "Lee SB, Frattini V, Bansal M, Castano AM, Sherman D, Hutchinson K, Bruce JN, Califano A, Liu G, Cardozo T, Iavarone A, Lasorella A", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "26735018", "url": "https://glygen.org/publication/PubMed/26735018" } ] }, { "title": "A protein induced by NGF in PC12 cells is stored in secretory vesicles and released through the regulated pathway.", "journal": "The EMBO journal", "date": "1989", "authors": "Possenti R, Eldridge JD, Paterson BM, Grasso A, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "2676516", "url": "https://glygen.org/publication/PubMed/2676516" } ] }, { "title": "Structural Basis for Substrate Selectivity of the E3 Ligase COP1.", "journal": "Structure (London, England : 1993)", "date": "2016", "authors": "Uljon S, Xu X, Durzynska I, Stein S, Adelmant G, Marto JA, Pear WS, Blacklow SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27041596", "url": "https://glygen.org/publication/PubMed/27041596" } ] }, { "title": "Combined Id1 and Id3 Deletion Leads to Severe Erythropoietic Disturbances.", "journal": "PloS one", "date": "2016", "authors": "Zhao Q, Chang C, Gonzalez JP, Alzahrani K, Button JL, Fraidenraich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27128622", "url": "https://glygen.org/publication/PubMed/27128622" } ] }, { "title": "Gene regulation in the immediate-early response process.", "journal": "Advances in biological regulation", "date": "2016", "authors": "Bahrami S, Drablos F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "27220739", "url": "https://glygen.org/publication/PubMed/27220739" } ] }, { "title": "Role for Egr1 in the Transcriptional Program Associated with Neuronal Differentiation of PC12 Cells.", "journal": "PloS one", "date": "2017", "authors": "Adams KW, Kletsov S, Lamm RJ, Elman JS, Mullenbrock S, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28076410", "url": "https://glygen.org/publication/PubMed/28076410" } ] }, { "title": "Binding and inhibition of the ternary complex factor Elk-4/Sap1 by the adapter protein Dok-4.", "journal": "The Biochemical journal", "date": "2017", "authors": "Hooker E, Baldwin C, Roodman V, Batra A, Isa NN, Takano T, Lemay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28275114", "url": "https://glygen.org/publication/PubMed/28275114" } ] }, { "title": "ERK-Induced Activation of TCF Family of SRF Cofactors Initiates a Chromatin Modification Cascade Associated with Transcription.", "journal": "Molecular cell", "date": "2017", "authors": "Esnault C, Gualdrini F, Horswell S, Kelly G, Stewart A, East P, Matthews N, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "28286024", "url": "https://glygen.org/publication/PubMed/28286024" } ] }, { "title": "The Arc of cognition: Signaling cascades regulating Arc and implications for cognitive function and disease.", "journal": "Seminars in cell & developmental biology", "date": "2018", "authors": "Epstein I, Finkbeiner S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "29559111", "url": "https://glygen.org/publication/PubMed/29559111" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q02363", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02363" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "A zinc finger-encoding gene coregulated with c-fos during growth and differentiation, and after cellular depolarization.", "journal": "Cell", "date": "1988", "authors": "Sukhatme VP, Cao XM, Chang LC, Tsai-Morris CH, Stamenkovich D, Ferreira PC, Cohen DR, Edwards SA, Shows TB, Curran T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3127059", "url": "https://glygen.org/publication/PubMed/3127059" } ] }, { "title": "Temporal Expression of Transcription Factor ID2 Improves Natural Killer Cell Differentiation from Human Pluripotent Stem Cells.", "journal": "ACS synthetic biology", "date": "2022", "authors": "Jung J, Chang Y, Jin G, Lian X, Bao X", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" } ], "reference": [ { "type": "PubMed", "id": "35608547", "url": "https://glygen.org/publication/PubMed/35608547" } ] }, { "title": "ID proteins promote the survival and primed-to-naive transition of human embryonic stem cells through TCF3-mediated transcription.", "journal": "Cell death & disease", "date": "2022", "authors": "Jiang H, Du M, Li Y, Zhou T, Lei J, Liang H, Zhong Z, Al-Lamki RS, Jiang M, Yang J", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" } ], "reference": [ { "type": "PubMed", "id": "35701409", "url": "https://glygen.org/publication/PubMed/35701409" } ] }, { "title": "GDF-11 promotes human trophoblast cell invasion by increasing ID2-mediated MMP2 expression.", "journal": "Cell communication and signaling : CCS", "date": "2022", "authors": "Wu Z, Fang L, Yang S, Gao Y, Wang Z, Meng Q, Dang X, Sun YP, Cheng JC", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" } ], "reference": [ { "type": "PubMed", "id": "35705978", "url": "https://glygen.org/publication/PubMed/35705978" } ] }, { "title": "A nerve growth factor-induced gene encodes a possible transcriptional regulatory factor.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "3672127", "url": "https://glygen.org/publication/PubMed/3672127" } ] }, { "title": "SMURF2 facilitates ubiquitin-mediated degradation of ID2 to attenuate lung cancer cell proliferation.", "journal": "International journal of biological sciences", "date": "2023", "authors": "Han Mingwei, Guo Yixiao, Li Yiming, Zeng Qingmei, Zhu Wanwan, Jiang Jianli", "evidence": [ { "database": "RefSeq", "id": "NP_002157", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002157" } ], "reference": [ { "type": "PubMed", "id": "37497010", "url": "https://glygen.org/publication/PubMed/37497010" } ] }, { "title": "Serine 133-phosphorylated CREB induces transcription via a cooperative mechanism that may confer specificity to neurotrophin signals.", "journal": "Molecular and cellular neurosciences", "date": "1995", "authors": "Bonni A, Ginty DD, Dudek H, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7551568", "url": "https://glygen.org/publication/PubMed/7551568" } ] }, { "title": "An isoform of the neuronal cyclin-dependent kinase 5 (Cdk5) activator.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Tang D, Yeung J, Lee KY, Matsushita M, Matsui H, Tomizawa K, Hatase O, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7592934", "url": "https://glygen.org/publication/PubMed/7592934" } ] }, { "title": "Tissue-specific processing of the neuroendocrine protein VGF.", "journal": "Journal of neurochemistry", "date": "1995", "authors": "Trani E, Ciotti T, Rinaldi AM, Canu N, Ferri GL, Levi A, Possenti R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7595538", "url": "https://glygen.org/publication/PubMed/7595538" } ] }, { "title": "Transcriptional activation of egr-1 by granulocyte-macrophage colony-stimulating factor but not interleukin 3 requires phosphorylation of cAMP response element-binding protein (CREB) on serine 133.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Lee HJ, Mignacca RC, Sakamoto KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7608156", "url": "https://glygen.org/publication/PubMed/7608156" } ] }, { "title": "Identification of NAB1, a repressor of NGFI-A- and Krox20-mediated transcription.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Russo MW, Sevetson BR, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7624335", "url": "https://glygen.org/publication/PubMed/7624335" } ] }, { "title": "Somatodendritic expression of an immediate early gene is regulated by synaptic activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7777577", "url": "https://glygen.org/publication/PubMed/7777577" } ] }, { "title": "A ternary complex factor-dependent mechanism mediates induction of egr-1 through selective serum response elements following antigen receptor cross-linking in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "McMahon SB, Monroe JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7823924", "url": "https://glygen.org/publication/PubMed/7823924" } ] }, { "title": "Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeleton-associated protein that is enriched in neuronal dendrites.", "journal": "Neuron", "date": "1995", "authors": "Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Gilbert DJ, Jenkins NA, Lanahan AA, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7857651", "url": "https://glygen.org/publication/PubMed/7857651" } ] }, { "title": "The neuron-restrictive silencer factor (NRSF): a coordinate repressor of multiple neuron-specific genes.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Schoenherr CJ, Anderson DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7871435", "url": "https://glygen.org/publication/PubMed/7871435" } ] }, { "title": "Characterization of Rad, a new member of Ras/GTPase superfamily, and its regulation by a unique GTPase-activating protein (GAP)-like activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zhu J, Reynet C, Caldwell JS, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7876254", "url": "https://glygen.org/publication/PubMed/7876254" } ] }, { "title": "Deficient long-term memory in mice with a targeted mutation of the cAMP-responsive element-binding protein.", "journal": "Cell", "date": "1994", "authors": "Bourtchuladze R, Frenguelli B, Blendy J, Cioffi D, Schutz G, Silva AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "7923378", "url": "https://glygen.org/publication/PubMed/7923378" } ] }, { "title": "p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Tsai LH, Delalle I, Caviness VS Jr, Chae T, Harlow E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090221", "url": "https://glygen.org/publication/PubMed/8090221" } ] }, { "title": "A brain-specific activator of cyclin-dependent kinase 5.", "journal": "Nature", "date": "1994", "authors": "Lew J, Huang QQ, Qi Z, Winkfein RJ, Aebersold R, Hunt T, Wang JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8090222", "url": "https://glygen.org/publication/PubMed/8090222" } ] }, { "title": "Rad: a member of the Ras family overexpressed in muscle of type II diabetic humans.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Reynet C, Kahn CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8248782", "url": "https://glygen.org/publication/PubMed/8248782" } ] }, { "title": "Id-related genes encoding helix-loop-helix proteins are required for G1 progression and are repressed in senescent human fibroblasts.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Hara E, Yamaguchi T, Nojima H, Ide T, Campisi J, Okayama H, Oda K", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "reference": [ { "type": "PubMed", "id": "8294468", "url": "https://glygen.org/publication/PubMed/8294468" } ] }, { "title": "Transcriptional activity of the zinc finger protein NGFI-A is influenced by its interaction with a cellular factor.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Russo MW, Matheny C, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8413279", "url": "https://glygen.org/publication/PubMed/8413279" } ] }, { "title": "Nerve growth factor induces transcription of NGFIA through complex regulatory elements that are also sensitive to serum and phorbol 12-myristate 13-acetate.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "DeFranco C, Damon DH, Endoh M, Wagner JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8483478", "url": "https://glygen.org/publication/PubMed/8483478" } ] }, { "title": "Transcriptional regulation of the tissue factor gene in human epithelial cells is mediated by Sp1 and EGR-1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Cui MZ, Parry GC, Oeth P, Larson H, Smith M, Huang RP, Adamson ED, Mackman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8576248", "url": "https://glygen.org/publication/PubMed/8576248" } ] }, { "title": "Increased expression of early growth response-1 messenger ribonucleic acid in prostatic adenocarcinoma.", "journal": "The Journal of urology", "date": "1996", "authors": "Thigpen AE, Cala KM, Guileyardo JM, Molberg KH, McConnell JD, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8583621", "url": "https://glygen.org/publication/PubMed/8583621" } ] }, { "title": "NAB2, a corepressor of NGFI-A (Egr-1) and Krox20, is induced by proliferative and differentiative stimuli.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Svaren J, Sevetson BR, Apel ED, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8668170", "url": "https://glygen.org/publication/PubMed/8668170" } ] }, { "title": "Activation of codependent transcription factors is required for transcriptional induction of the vgf gene by nerve growth factor and Ras.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "D'Arcangelo G, Habas R, Wang S, Halegoua S, Salton SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8756618", "url": "https://glygen.org/publication/PubMed/8756618" } ] }, { "title": "The cdk5/p35 kinase is essential for neurite outgrowth during neuronal differentiation.", "journal": "Genes & development", "date": "1996", "authors": "Nikolic M, Dudek H, Kwon YT, Ramos YF, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8846918", "url": "https://glygen.org/publication/PubMed/8846918" } ] }, { "title": "The transcription factors SCIP and Krox-20 mark distinct stages and cell fates in Schwann cell differentiation.", "journal": "Molecular and cellular neurosciences", "date": "1996", "authors": "Zorick TS, Syroid DE, Arroyo E, Scherer SS, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "8918830", "url": "https://glygen.org/publication/PubMed/8918830" } ] }, { "title": "Cdk2-dependent phosphorylation of Id2 modulates activity of E2A-related transcription factors.", "journal": "The EMBO journal", "date": "1997", "authors": "Hara E, Hall M, Peters G", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "9029153", "url": "https://glygen.org/publication/PubMed/9029153" } ] }, { "title": "Interplay of the E box, the cyclic AMP response element, and HTF4/HEB in transcriptional regulation of the neurospecific, neurotrophin-inducible vgf gene.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Di Rocco G, Pennuto M, Illi B, Canu N, Filocamo G, Trani E, Rinaldi AM, Possenti R, Mandolesi G, Sirinian MI, Jucker R, Levi A, Nasi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9032251", "url": "https://glygen.org/publication/PubMed/9032251" } ] }, { "title": "Molecular cloning and characterization of the human VGF promoter region.", "journal": "Journal of neurochemistry", "date": "1997", "authors": "Canu N, Possenti R, Rinaldi AM, Trani E, Levi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9084409", "url": "https://glygen.org/publication/PubMed/9084409" } ] }, { "title": "Role of cyclins in neuronal differentiation of immortalized hippocampal cells.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Xiong W, Pestell R, Rosner MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9343422", "url": "https://glygen.org/publication/PubMed/9343422" } ] }, { "title": "Regulation of Id3 cell cycle function by Cdk-2-dependent phosphorylation.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Deed RW, Hara E, Atherton GT, Peters G, Norton JD", "evidence": [ { "database": "iPTMnet", "id": "Q02363", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02363" } ], "reference": [ { "type": "PubMed", "id": "9372912", "url": "https://glygen.org/publication/PubMed/9372912" } ] }, { "title": "CREB: a major mediator of neuronal neurotrophin responses.", "journal": "Neuron", "date": "1997", "authors": "Finkbeiner S, Tavazoie SF, Maloratsky A, Jacobs KM, Harris KM, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9390517", "url": "https://glygen.org/publication/PubMed/9390517" } ] }, { "title": "Nab1, a corepressor of NGFI-A (Egr-1), contains an active transcriptional repression domain.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Swirnoff AH, Apel ED, Svaren J, Sevetson BR, Zimonjic DB, Popescu NC, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9418898", "url": "https://glygen.org/publication/PubMed/9418898" } ] }, { "title": "Expression of early growth response genes in human prostate cancer.", "journal": "Cancer research", "date": "1998", "authors": "Eid MA, Kumar MV, Iczkowski KA, Bostwick DG, Tindall DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9622090", "url": "https://glygen.org/publication/PubMed/9622090" } ] }, { "title": "The transcriptional corepressor NAB2 inhibits NGF-induced differentiation of PC12 cells.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Qu Z, Wolfraim LA, Svaren J, Ehrengruber MU, Davidson N, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9722618", "url": "https://glygen.org/publication/PubMed/9722618" } ] }, { "title": "Rsk-2 activity is necessary for epidermal growth factor-induced phosphorylation of CREB protein and transcription of c-fos gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "De Cesare D, Jacquot S, Hanauer A, Sassone-Corsi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9770464", "url": "https://glygen.org/publication/PubMed/9770464" } ] }, { "title": "Novel mutants of NAB corepressors enhance activation by Egr transactivators.", "journal": "The EMBO journal", "date": "1998", "authors": "Svaren J, Sevetson BR, Golda T, Stanton JJ, Swirnoff AH, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9774344", "url": "https://glygen.org/publication/PubMed/9774344" } ] }, { "title": "Synaptic activation causes the mRNA for the IEG Arc to localize selectively near activated postsynaptic sites on dendrites.", "journal": "Neuron", "date": "1998", "authors": "Steward O, Wallace CS, Lyford GL, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9808461", "url": "https://glygen.org/publication/PubMed/9808461" } ] }, { "title": "Evidence for the participation of the neuron-specific CDK5 activator P35 during laminin-enhanced axonal growth.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1998", "authors": "Paglini G, Pigino G, Kunda P, Morfini G, Maccioni R, Quiroga S, Ferreira A, Caceres A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9822744", "url": "https://glygen.org/publication/PubMed/9822744" } ] }, { "title": "Inducible and constitutive transcription factors in the mammalian nervous system: control of gene expression by Jun, Fos and Krox, and CREB/ATF proteins.", "journal": "Brain research. Brain research reviews", "date": "1998", "authors": "Herdegen T, Leah JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9031628", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628" } ], "reference": [ { "type": "PubMed", "id": "9858769", "url": "https://glygen.org/publication/PubMed/9858769" } ] } ], "pathway": [ { "id": "hsa:3398", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3398", "resource": "KEGG Pathway" }, { "id": "R-HSA-9031628", "name": "NGF-stimulated transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9031628", "resource": "Reactome", "description": "NGF-stimulated transcription" } ], "orthologs": [ { "uniprot_canonical_ac": "P41136-1", "protein_name": "DNA-binding protein inhibitor ID-2", "gene_name": "Id2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG", "length": 134 }, "evidence": [ { "id": "45225554", "url": "http://www.informatics.jax.org/homology/45225554", "database": "MGI" }, { "id": "Q02363", "url": "https://omabrowser.org/oma/group/Q02363/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P41137-1", "protein_name": "DNA-binding protein inhibitor ID-2", "gene_name": "Id2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG", "length": 134 }, "evidence": [ { "id": "45225554", "url": "http://www.informatics.jax.org/homology/45225554", "database": "MGI" }, { "id": "Q02363", "url": "https://omabrowser.org/oma/group/Q02363/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 35, "go_terms": [ { "name": "enucleate erythrocyte differentiation", "id": "GO:0043353", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043353", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of transcription involved in G1/S transition of mitotic cell cycle", "id": "GO:0071931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071931", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "bundle of His development", "id": "GO:0003166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003166", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "endodermal digestive tract morphogenesis", "id": "GO:0061031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061031", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of fat cell differentiation", "id": "GO:0045600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045600", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of blood pressure", "id": "GO:0045777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045777", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "regulation of lipid metabolic process", "id": "GO:0019216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019216", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "regulation of neuron differentiation", "id": "GO:0045664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045664", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "mammary gland alveolus development", "id": "GO:0060749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060749", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "locomotor rhythm", "id": "GO:0045475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045475", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "cellular senescence", "id": "GO:0090398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090398", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "neuron fate commitment", "id": "GO:0048663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048663", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of macrophage differentiation", "id": "GO:0045651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045651", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of muscle cell differentiation", "id": "GO:0051148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051148", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "entrainment of circadian clock by photoperiod", "id": "GO:0043153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043153", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of DNA-binding transcription factor activity", "id": "GO:0043433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043433", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000045", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "positive regulation of astrocyte differentiation", "id": "GO:0048711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048711", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "mammary gland epithelial cell proliferation", "id": "GO:0033598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033598", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "olfactory bulb development", "id": "GO:0021772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021772", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "embryonic digestive tract morphogenesis", "id": "GO:0048557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048557", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "epithelial cell differentiation involved in mammary gland alveolus development", "id": "GO:0061030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061030", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "regulation of neural precursor cell proliferation", "id": "GO:2000177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000177", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "negative regulation of B cell differentiation", "id": "GO:0045578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045578", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "transmembrane transporter binding", "id": "GO:0044325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044325", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" }, { "name": "transcription regulator inhibitor activity", "id": "GO:0140416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140416", "evidence": [ { "database": "UniProtKB", "id": "Q02363", "url": "https://www.uniprot.org/uniprot/Q02363" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 141 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }