{ "uniprot_canonical_ac": "Q02105-1", "uniprot_ac": "Q02105", "uniprot_id": "C1QC_MOUSE", "mass": { "chemical_mass": 25992.0, "monoisotopic_mass": 25992.0 }, "refseq": { "ac": "NP_031600", "name": "complement C1q subcomponent subunit C precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600" }, "gene_names": [ { "name": "C1qc", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q02105", "id": "Q02105" }, { "name": "Adib; C1qg; Ciqc", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600", "id": "NP_031600" }, { "name": "C1qc", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600", "id": "NP_031600" }, { "name": "C1qg", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q02105", "id": "Q02105" } ], "protein_names": [ { "name": "Complement C1q subcomponent subunit C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q02105" }, { "name": "complement C1q subcomponent subunit C precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600", "id": "NP_031600" }, { "name": "complement component 1, q subcomponent, gamma polypeptide; complement C1q subcomponent subunit C; complement component 1, q subcomponent, c polypeptide; adiponectin b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600", "id": "NP_031600" } ], "function": [ { "annotation": "C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "common_name": "Mouse" } ], "gene": [ { "name": "C1qc", "url": "https://www.uniprot.org/uniprot/Q02105", "locus": { "chromosome": "4", "start_pos": 136617115, "end_pos": 136620376, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000036896", "url": "https://www.ensembl.org/id/ENSMUSG00000036896" } ] } } ], "crossref": [ { "id": "ENSMUSG00000036896", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036896", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "12262", "url": "https://www.ncbi.nlm.nih.gov/gene/12262", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q02105", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q02105*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12262", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12262", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "88225", "url": "http://www.informatics.jax.org/marker/MGI:88225", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q02105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02105", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RGTNEYP", "url": "https://omabrowser.org/oma/group/RGTNEYP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3683851at2759", "url": "http://www.orthodb.org/?query=3683851at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15427", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15427", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15427:SF29", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15427:SF29", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00386", "url": "http://pfam.xfam.org/family/PF00386", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01391", "url": "http://pfam.xfam.org/family/PF01391", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q02105", "url": "http://purl.obolibrary.org/obo/PR_Q02105", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-166663", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-173623", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031600", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031600", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q02105-1", "url": "https://www.uniprot.org/uniprot/Q02105-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGEPGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD", "length": 246, "header": "sp|Q02105-1|C1QC_MOUSE Isoform 1 of Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2 CANONICAL=Q02105-1" }, "isoforms": [ { "isoform_ac": "Q02105-1", "url": "", "sequence": { "sequence": "MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGEPGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD", "length": 246, "header": "sp|Q02105-1|C1QC_MOUSE Isoform 1 of Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2 CANONICAL=Q02105-1" }, "locus": { "chromosome": "4", "start_pos": 136619873, "end_pos": 136617357, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000046332", "url": "https://www.ensembl.org/id/ENSMUST00000046332" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000036747", "url": "https://www.ensembl.org/id/ENSMUSP00000036747" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q02105", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02105" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation, sequence analysis and characterization of cDNA clones coding for the C chain of mouse C1q. Sequence similarity of complement subcomponent C1q, collagen type VIII and type X and precerebellin.", "journal": "Eur. J. Biochem.", "date": "1992", "authors": "Petry F, Reid KB, Loos M", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "reference": [ { "type": "PubMed", "id": "1396691", "url": "https://glygen.org/publication/PubMed/1396691" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q02105", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q02105" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "The mouse C1q genes are clustered on chromosome 4 and show conservation of gene organization.", "journal": "Immunogenetics", "date": "1996", "authors": "Petry F, McClive PJ, Botto M, Morley BJ, Morahan G, Loos M", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "reference": [ { "type": "PubMed", "id": "8606057", "url": "https://glygen.org/publication/PubMed/8606057" } ] } ], "pathway": [ { "id": "mmu:12262", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12262", "resource": "KEGG Pathway" }, { "id": "R-MMU-166663", "name": "Initial triggering of complement", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-166663", "resource": "Reactome", "description": "Initial triggering of complement" }, { "id": "R-MMU-173623", "name": "Classical antibody-mediated complement activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-173623", "resource": "Reactome", "description": "Classical antibody-mediated complement activation" }, { "id": "R-MMU-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD", "length": 245 }, "evidence": [ { "id": "45230369", "url": "http://www.informatics.jax.org/homology/45230369", "database": "MGI" }, { "id": "Q02105", "url": "https://omabrowser.org/oma/group/Q02105/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P31722-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1qc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVVGTSCQPQHGLYLLLLLLALPLRSQANAGCYGIPGMPGLPGTPGKDGHDGLQGPKGEPGIPAIPGTQGPKGQKGEPGMPGHRGKNGPMGTSGSPGDPGPRGPPGEPGEEGRYKQKHQSVFTVTRQTAQYPAANGLVKFNSAITNPQGDYNTNTGKFTCKVPGLYYFVHHTSQTANLCVQLLLNNAKVTSFCDHMSNSKQVSSGGVLLRLQRGDEVWLAVNDYNGMVGTEGSDSVFSGFLLFPD", "length": 245 }, "evidence": [ { "id": "45230369", "url": "http://www.informatics.jax.org/homology/45230369", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "postsynapse", "id": "GO:0098794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "collagen trimer", "id": "GO:0005581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005581", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "complement component C1 complex", "id": "GO:0005602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005602", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "complement component C1q complex", "id": "GO:0062167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062167", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "negative regulation of granulocyte differentiation", "id": "GO:0030853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030853", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "negative regulation of macrophage differentiation", "id": "GO:0045650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045650", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "synapse pruning", "id": "GO:0098883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098883", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" }, { "name": "complement activation, classical pathway", "id": "GO:0006958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "database": "UniProtKB", "id": "Q02105", "url": "https://www.uniprot.org/uniprot/Q02105" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }