{ "uniprot_canonical_ac": "Q01129-1", "uniprot_ac": "Q01129", "uniprot_id": "PGS2_RAT", "mass": { "chemical_mass": 39805.0, "monoisotopic_mass": 39805.0 }, "refseq": { "ac": "NP_077043", "name": "decorin precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" }, "gene_names": [ { "name": "Dcn", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q01129", "id": "Q01129" }, { "name": "Dcn", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043", "id": "NP_077043" } ], "protein_names": [ { "name": "Decorin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q01129" }, { "name": "Bone proteoglycan II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q01129" }, { "name": "DSPG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q01129" }, { "name": "Dermatan sulfate proteoglycan-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q01129" }, { "name": "PG-S2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q01129" }, { "name": "PG40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q01129" }, { "name": "decorin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043", "id": "NP_077043" }, { "name": "dermatan sulfate proteoglycan-II (decorin); DSPG; PG40; PG-S2; bone proteoglycan II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043", "id": "NP_077043" } ], "function": [ { "annotation": "Decorin Protects Cardiac Myocytes against Simulated Ischemia/Reperfusion Injury. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" }, { "database": "PubMed", "id": "32731559", "url": "https://glygen.org/publication/PubMed/32731559" } ] }, { "annotation": "May affect the rate of fibrils formation (By similarity). May be implicated in the dilatation of the rat cervix.", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129#function" } ] }, { "annotation": "May affect the rate of fibrils formation.", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AAW0", "url": "https://www.uniprot.org/uniprot/A0A8I6AAW0#function" }, { "database": "UniProtKB", "id": "RU364097", "url": "https://www.uniprot.org/uniprot/RU364097#function" }, { "database": "UniProtKB", "id": "PIRNR002490", "url": "https://www.uniprot.org/uniprot/PIRNR002490#function" }, { "database": "UniProtKB", "id": "A0A8I6GFI0", "url": "https://www.uniprot.org/uniprot/A0A8I6GFI0#function" } ] }, { "annotation": "Overexpression of decorin ameliorated diabetic cardiomyopathy and promoted angiogenesis through the IGF1R-AKT-VEGF signaling pathway in vivo and in vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" }, { "database": "PubMed", "id": "28290552", "url": "https://glygen.org/publication/PubMed/28290552" } ] }, { "annotation": "The myokine decorin improves the cardiac function in a rat model of isoprenaline-induced myocardial infarction.", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" }, { "database": "PubMed", "id": "36917819", "url": "https://glygen.org/publication/PubMed/36917819" } ] } ], "disease": [ { "disease_id": "DOID:0060445", "recommended_name": { "id": "DOID:0060445", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060445", "name": "congenital stromal corneal dystrophy", "description": "A stromal dystrophy that is characterized by the presence of bilateral corneal opacities that can be seen at or shortly after birth." }, "synonyms": [ { "id": "DOID:0060445", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060445", "name": "CSCD", "description": "" }, { "id": "DOID:0060445", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060445", "name": "congenital hereditary stromal dystrophy", "description": "" }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "congenital stromal corneal dystrophy", "description": "Congenital stromal corneal dystrophy (CSCD) is an extremely rare form of stromal corneal dystrophy characterized by opaque flaky or feathery clouding of the corneal stroma, and moderate to severe visual loss." }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "CSCD", "description": "" }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "Witschel dystrophy", "description": "" }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "congenital hereditary stromal dystrophy", "description": "" }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "congenital stromal corneal dystrophy", "description": "" }, { "id": "MONDO:0012401", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012401", "name": "corneal dystrophy, congenital stromal", "description": "" }, { "id": "MIM:610048", "resource": "MIM", "url": "https://www.omim.org/entry/610048", "name": "Corneal dystrophy, congenital stromal", "description": "Corneal dystrophy, congenital stromal" } ], "evidence": [ { "id": "0060445", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060445" } ] }, { "disease_id": "DOID:11714", "recommended_name": { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "gestational diabetes", "description": "A diabetes mellitus that manifests during pregnancy." }, "synonyms": [ { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "GDM", "description": "" }, { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "Gestational diabetes mellitus", "description": "" }, { "id": "DOID:11714", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11714", "name": "Maternal gestational diabetes mellitus", "description": "" } ], "evidence": [ { "id": "11714", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11714" } ] }, { "disease_id": "DOID:13359", "recommended_name": { "id": "DOID:13359", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13359", "name": "Ehlers-Danlos syndrome", "description": "A collagen disease that is characterized by extremely flexible joints, elastic skin, and excessive bruising caused by a heritable defect in collagen synthesis, which leads to marked healing difficulties. EDS has five cardinal signs, which may be present to some degree in all of the subtypes. These five cardinal signs are skin fragility, blood vessel fragility, skin hyperelasticity, joint hypermobility, and characteristic subcutaneous nodules." }, "synonyms": [ { "id": "DOID:13359", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13359", "name": "Cutis hyperelastica", "description": "" }, { "id": "DOID:13359", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13359", "name": "elastic skin", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "Ehlers-Danlos syndrome, classic type, 1", "description": "Any Ehlers-Danlos syndrome in which the cause of the disease is a mutation in the COL5A1 gene." }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "EDS I", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "EDSCL1", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "Ehlers-Danlos syndrome, classic type, 1", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "Ehlers-Danlos syndrome, type 1", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "Ehlers-Danlos syndrome, type I", "description": "" }, { "id": "MONDO:0019567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019567", "name": "type I Ehlers-Danlos syndrome", "description": "" }, { "id": "MIM:130000", "resource": "MIM", "url": "https://www.omim.org/entry/130000", "name": "Ehlers-Danlos syndrome, classic type, 1", "description": "Ehlers-Danlos syndrome, classic type, 1" } ], "evidence": [ { "id": "13359", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13359" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:3070", "recommended_name": { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "high grade glioma", "description": "A cell type cancer that has_material_basis_in glial cells and is located in brain or located in spine." }, "synonyms": [ { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant glioma", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glial cell tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glioma, malignant", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant Neuroglial tumor", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "GLM1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma, susceptibility to, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "astrocytoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "ependymoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma multiforme", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma of brain, familial", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "oligodendroglioma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "subependymoma", "description": "" }, { "id": "MIM:137800", "resource": "MIM", "url": "https://www.omim.org/entry/137800", "name": "Glioma 1", "description": "Glioma 1" } ], "evidence": [ { "id": "3070", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3070" } ] }, { "disease_id": "DOID:3459", "recommended_name": { "id": "DOID:3459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3459", "name": "breast carcinoma", "description": "A breast cancer that has_material_basis_in abnormally proliferating cells derives_from epithelial cells." }, "synonyms": [ { "id": "DOID:3459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3459", "name": "Mammary carcinoma", "description": "" }, { "id": "DOID:3459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3459", "name": "carcinoma of breast", "description": "" } ], "evidence": [ { "id": "3459", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3459" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dcn", "url": "https://www.uniprot.org/uniprot/Q01129", "locus": { "chromosome": "7", "start_pos": 32321270, "end_pos": 32281252, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004554", "url": "https://www.ensembl.org/id/ENSRNOG00000004554" } ] } } ], "crossref": [ { "id": "ENSRNOG00000004554", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004554", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "29139", "url": "https://www.ncbi.nlm.nih.gov/gene/29139", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q01129", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q01129*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000372", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000372", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003591", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003591", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:29139", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29139", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WAKPFHQ", "url": "https://omabrowser.org/oma/group/WAKPFHQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3953748at2759", "url": "http://www.orthodb.org/?query=3953748at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45712", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45712", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45712:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45712:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01462", "url": "http://pfam.xfam.org/family/PF01462", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13855", "url": "http://pfam.xfam.org/family/PF13855", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q01129", "url": "http://purl.obolibrary.org/obo/PR_Q01129", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1474228", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1971475", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022923", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2024101", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "61895", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=61895", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AAW0", "url": "https://www.uniprot.org/uniprot/A0A8I6AAW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AAW0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AAW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GFI0", "url": "https://www.uniprot.org/uniprot/A0A8I6GFI0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GFI0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GFI0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q01129-1", "url": "https://www.uniprot.org/uniprot/Q01129-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKATLVLFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK", "length": 354, "header": "sp|Q01129-1|PGS2_RAT Isoform 1 of Decorin OS=Rattus norvegicus OX=10116 GN=Dcn PE=1 SV=1 CANONICAL=Q01129-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AAW0-1", "url": "", "sequence": { "sequence": "MVVKTHETTMKATLVLFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK", "length": 363, "header": "tr|A0A8I6AAW0-1|A0A8I6AAW0_RAT Computationally mapped isoform of Decorin OS=Rattus norvegicus OX=10116 GN=Dcn PE=1 SV=1 CANONICAL=Q01129-1" }, "locus": { "chromosome": "7", "start_pos": 32320781, "end_pos": 32284733, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000100641.1", "url": "https://www.ensembl.org/id/ENSRNOT00000100641.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000088475.1", "url": "https://www.ensembl.org/id/ENSRNOP00000088475.1" } ] } }, { "isoform_ac": "A0A8I6GFI0-1", "url": "", "sequence": { "sequence": "MIWHKRNVQSRNELEIFTTVYEVVKTHETTMKATLVLFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK", "length": 384, "header": "tr|A0A8I6GFI0-1|A0A8I6GFI0_RAT Computationally mapped isoform of Decorin OS=Rattus norvegicus OX=10116 GN=Dcn PE=1 SV=1 CANONICAL=Q01129-1" }, "locus": { "chromosome": "7", "start_pos": 32320781, "end_pos": 32284527, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000116661.1", "url": "https://www.ensembl.org/id/ENSRNOT00000116661.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086944.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086944.1" } ] } }, { "isoform_ac": "Q01129-1", "url": "", "sequence": { "sequence": "MKATLVLFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK", "length": 354, "header": "sp|Q01129-1|PGS2_RAT Isoform 1 of Decorin OS=Rattus norvegicus OX=10116 GN=Dcn PE=1 SV=1 CANONICAL=Q01129-1" }, "locus": { "chromosome": "7", "start_pos": 32320781, "end_pos": 32285083, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000006070", "url": "https://www.ensembl.org/id/ENSRNOT00000006070" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000006070", "url": "https://www.ensembl.org/id/ENSRNOP00000006070" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 206, "start_aa": "Asn", "end_pos": 206, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn206", "evidence": [ { "id": "Q01129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "Q01129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "Q01129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 298, "start_aa": "Asn", "end_pos": 298, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn298", "evidence": [ { "id": "Q01129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (glycosaminoglycan) serine", "start_pos": 34, "start_aa": "Ser", "end_pos": 34, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser34", "evidence": [ { "id": "Q01129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" }, { "id": "2764879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2764879" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported" ], "publication": [ { "title": "cDNA sequence for rat dermatan sulfate proteoglycan-II (decorin).", "journal": "Biochim. Biophys. Acta", "date": "1992", "authors": "Abramson SR, Woessner JF Jr", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "reference": [ { "type": "PubMed", "id": "1390895", "url": "https://glygen.org/publication/PubMed/1390895" } ] }, { "title": "Molecular characterization of vascular smooth muscle decorin: deduced core protein structure and regulation of gene expression.", "journal": "Eur. J. Cell Biol.", "date": "1992", "authors": "Asundi V.K., Dreher K.L.", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "reference": [ { "type": "PubMed", "id": "1493796", "url": "https://glygen.org/publication/PubMed/1493796" } ] }, { "title": "Peptidomics for studying limited proteolysis.", "journal": "J. Proteome Res.", "date": "2015", "authors": "Tsuchiya T, Osaki T, Minamino N, Sasaki K", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "reference": [ { "type": "PubMed", "id": "26479776", "url": "https://glygen.org/publication/PubMed/26479776" } ] }, { "title": "Purification and characterization of a small dermatan sulphate proteoglycan implicated in the dilatation of the rat uterine cervix.", "journal": "The Biochemical journal", "date": "1989", "authors": "Kokenyesi R, Woessner JF Jr", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129#ptm_processing" }, { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "reference": [ { "type": "PubMed", "id": "2764879", "url": "https://glygen.org/publication/PubMed/2764879" } ] }, { "title": "Overexpression of decorin promoted angiogenesis in diabetic cardiomyopathy via IGF1R-AKT-VEGF signaling.", "journal": "Scientific reports", "date": "2017", "authors": "Lai J, Chen F, Chen J, Ruan G, He M, Chen C, Tang J, Wang DW", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" } ], "reference": [ { "type": "PubMed", "id": "28290552", "url": "https://glygen.org/publication/PubMed/28290552" } ] }, { "title": "Decorin Protects Cardiac Myocytes against Simulated Ischemia/Reperfusion Injury.", "journal": "Molecules (Basel, Switzerland)", "date": "2020", "authors": "Gaspar R, Gomori K, Kiss B, Szantai A, Paloczi J, Varga ZV, Pipis J, Varadi B, Agg B, Csont T, Ferdinandy P, Bartekova M, Gorbe A", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" } ], "reference": [ { "type": "PubMed", "id": "32731559", "url": "https://glygen.org/publication/PubMed/32731559" } ] }, { "title": "The myokine decorin improves the cardiac function in a rat model of isoprenaline-induced myocardial infarction.", "journal": "Canadian journal of physiology and pharmacology", "date": "2023", "authors": "Hassan GM, Ebrahim RH", "evidence": [ { "database": "RefSeq", "id": "NP_077043", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077043" } ], "reference": [ { "type": "PubMed", "id": "36917819", "url": "https://glygen.org/publication/PubMed/36917819" } ] } ], "pathway": [ { "id": "rno:29139", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29139", "resource": "KEGG Pathway" }, { "id": "R-RNO-1474228", "name": "Degradation of the extracellular matrix", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1474228", "resource": "Reactome", "description": "Degradation of the extracellular matrix" }, { "id": "R-RNO-1971475", "name": "A tetrasaccharide linker sequence is required for GAG synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1971475", "resource": "Reactome", "description": "A tetrasaccharide linker sequence is required for GAG synthesis" }, { "id": "R-RNO-2022870", "name": "Chondroitin sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022870", "resource": "Reactome", "description": "Chondroitin sulfate biosynthesis" }, { "id": "R-RNO-2022923", "name": "Dermatan sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022923", "resource": "Reactome", "description": "Dermatan sulfate biosynthesis" }, { "id": "R-RNO-2024101", "name": "CS/DS degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2024101", "resource": "Reactome", "description": "CS/DS degradation" }, { "id": "R-RNO-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3000178", "resource": "Reactome", "description": "ECM proteoglycans" } ], "orthologs": [ { "uniprot_canonical_ac": "P07585-1", "protein_name": "Decorin", "gene_name": "DCN", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK", "length": 359 }, "evidence": [ { "id": "45224880", "url": "http://www.informatics.jax.org/homology/45224880", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P28654-1", "protein_name": "Decorin", "gene_name": "Dcn", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK", "length": 354 }, "evidence": [ { "id": "45224880", "url": "http://www.informatics.jax.org/homology/45224880", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "collagen type VI trimer", "id": "GO:0005589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005589", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "placenta development", "id": "GO:0001890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001890", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of autophagy", "id": "GO:0010508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010508", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell migration", "id": "GO:0010596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010596", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of macroautophagy", "id": "GO:0016239", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016239", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "negative regulation of vascular endothelial growth factor signaling pathway", "id": "GO:1900747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900747", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial depolarization", "id": "GO:0051901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051901", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase signaling", "id": "GO:0014068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014068", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "skeletal muscle tissue development", "id": "GO:0007519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007519", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan", "id": "GO:0019800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019800", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial fission", "id": "GO:0090141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090141", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "collagen binding", "id": "GO:0005518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005518", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" }, { "name": "glycosaminoglycan binding", "id": "GO:0005539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005539", "evidence": [ { "database": "UniProtKB", "id": "Q01129", "url": "https://www.uniprot.org/uniprot/Q01129" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 206, "end_pos": 208, "annotation": "n_glycosylation_sequon" }, { "start_pos": 241, "end_pos": 243, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 298, "end_pos": 300, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }