{ "uniprot_canonical_ac": "Q00715-1", "uniprot_ac": "Q00715", "uniprot_id": "H2B1_RAT", "mass": { "chemical_mass": 13990.0, "monoisotopic_mass": 13990.0 }, "refseq": { "ac": "NP_072173", "name": "histone H2B type 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173" }, "gene_names": [ { "name": "H2b; Hist1h2bl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173", "id": "NP_072173" }, { "name": "Hist1h2bg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173", "id": "NP_072173" } ], "protein_names": [ { "name": "Histone H2B type 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q00715" }, { "name": "histone 2b; histone 1, H2bl; histone cluster 1, H2bl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173", "id": "NP_072173" }, { "name": "histone H2B type 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173", "id": "NP_072173" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715#function" } ] }, { "annotation": "H3, H4 and H2B underwent differential acetylation at specific sites depending on whether rats had been exposed to the context of a task without having to learn or had to learn about a place or fear.", "evidence": [ { "database": "RefSeq", "id": "NP_072173", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173" }, { "database": "PubMed", "id": "23469244", "url": "https://glygen.org/publication/PubMed/23469244" } ] }, { "annotation": "Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "common_name": "Rat" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q00715", "locus": {} } ], "crossref": [ { "id": "64647", "url": "https://www.ncbi.nlm.nih.gov/gene/64647", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q00715", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q00715*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000558", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000558", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:64647", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64647", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q00715", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q00715", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "4736903at2759", "url": "http://www.orthodb.org/?query=4736903at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23428", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23428", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23428:SF250", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23428:SF250", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00125", "url": "http://pfam.xfam.org/family/PF00125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q00715", "url": "http://purl.obolibrary.org/obo/PR_Q00715", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_072173", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q00715-1", "url": "https://www.uniprot.org/uniprot/Q00715-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK", "length": 125, "header": "sp|Q00715-1|H2B1_RAT Isoform 1 of Histone H2B type 1 OS=Rattus norvegicus OX=10116 GN= PE=1 SV=2 CANONICAL=Q00715-1" }, "isoforms": [ { "isoform_ac": "Q00715-1", "url": "", "sequence": { "sequence": "MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK", "length": 125, "header": "sp|Q00715-1|H2B1_RAT Isoform 1 of Histone H2B type 1 OS=Rattus norvegicus OX=10116 GN= PE=1 SV=2 CANONICAL=Q00715-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine O-GlcNAcylation", "start_pos": 112, "start_aa": "Ser", "end_pos": 112, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser112", "evidence": [ { "id": "Q00715", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00715#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q00715", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q00715" }, { "id": "34502162", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34502162" } ] } ], "phosphorylation": [ { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "site_lbl": "Thr115" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK4/MST1", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "site_lbl": "Ser15" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "site_lbl": "Ser37" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Inhibition of core histones acetylation by carcinogenic nickel(II).", "journal": "Mol. Cell. Biochem.", "date": "2005", "authors": "Golebiowski F, Kasprzak KS", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "reference": [ { "type": "PubMed", "id": "16283522", "url": "https://glygen.org/publication/PubMed/16283522" } ] }, { "title": "Presence of a bi-directional S phase-specific transcription regulatory element in the promoter shared by testis-specific TH2A and TH2B histone genes.", "journal": "Nucleic Acids Res.", "date": "1991", "authors": "Huh NE, Hwang IW, Lim K, You KH, Chae CB", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "reference": [ { "type": "PubMed", "id": "2011515", "url": "https://glygen.org/publication/PubMed/2011515" } ] }, { "title": "Detection of histone acetylation levels in the dorsal hippocampus reveals early tagging on specific residues of H2B and H4 histones in response to learning.", "journal": "PloS one", "date": "2013", "authors": "Bousiges O, Neidl R, Majchrzak M, Muller MA, Barbelivien A, Pereira de Vasconcelos A, Schneider A, Loeffler JP, Cassel JC, Boutillier AL", "evidence": [ { "database": "RefSeq", "id": "NP_072173", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072173" } ], "reference": [ { "type": "PubMed", "id": "23469244", "url": "https://glygen.org/publication/PubMed/23469244" } ] }, { "title": "An O-GlcNAcylomic Approach Reveals ACLY as a Potential Target in Sepsis in the Young Rat.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Denis M, Dupas T, Persello A, Dontaine J, Bultot L, Betus C, Pele T, Dhot J, Erraud A, Maillard A, Montnach J, Leroux AA, Bigot-Corbel E, Vertommen D, Riviere M, Lebreton J, Tessier A, Waard M, Bertrand L, Rozec B, Lauzier B", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q00715", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q00715" } ], "reference": [ { "type": "PubMed", "id": "34502162", "url": "https://glygen.org/publication/PubMed/34502162" } ] }, { "title": "Molecular cloning and differential expression of somatic and testis-specific H2B histone genes during rat spermatogenesis.", "journal": "Dev. Biol.", "date": "1987", "authors": "Kim Y.-J., Kierszenbaum A.L., Tres L.L., Chae C.-B., Hwang I.", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "reference": [ { "type": "PubMed", "id": "3666307", "url": "https://glygen.org/publication/PubMed/3666307" } ] } ], "pathway": [ { "id": "rno:64647", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64647", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q64478-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2bc9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPEPAKSAPAPKKGSKKALTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK", "length": 126 }, "evidence": [ { "id": "45236908", "url": "http://www.informatics.jax.org/homology/45236908", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK", "length": 126 }, "evidence": [ { "id": "45236908", "url": "http://www.informatics.jax.org/homology/45236908", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "ADP-ribosylated by PARP1 or PARP2 on Ser-7 (H2BS6ADPr) in response to DNA damage (By similarity). H2BS6ADPr promotes recruitment of CHD1L (By similarity). Mono-ADP-ribosylated on Glu-3 (H2BE2ADPr) by PARP3 in response to single-strand breaks (By similarity). Poly ADP-ribosylation on Glu-36 (H2BE35ADPr) by PARP1 regulates adipogenesis: it inhibits phosphorylation at Ser-37 (H2BS36ph), thereby blocking expression of pro-adipogenetic genes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P33778", "url": "https://glygen.org/publication/PubMed/P33778" }, { "database": "PubMed", "id": "Q6ZWY9", "url": "https://glygen.org/publication/PubMed/Q6ZWY9" } ] }, { "annotation": "Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P33778", "url": "https://glygen.org/publication/PubMed/P33778" } ] }, { "annotation": "GlcNAcylation at Ser-112 promotes monoubiquitination of Lys-120. It fluctuates in response to extracellular glucose, and associates with transcribed genes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P62807", "url": "https://glygen.org/publication/PubMed/P62807" } ] }, { "annotation": "Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P33778", "url": "https://glygen.org/publication/PubMed/P33778" } ] }, { "annotation": "Monoubiquitination at Lys-35 (H2BK34Ub) by the MSL1/MSL2 dimer is required for histone H3 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) methylation and transcription activation at specific gene loci, such as HOXA9 and MEIS1 loci. Similarly, monoubiquitination at Lys-120 (H2BK120Ub) by the RNF20/40 complex gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It also functions cooperatively with the FACT dimer to stimulate elongation by RNA polymerase II. H2BK120Ub also acts as a regulator of mRNA splicing: deubiquitination by USP49 is required for efficient cotranscriptional splicing of a large set of exons (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P33778", "url": "https://glygen.org/publication/PubMed/P33778" } ] }, { "annotation": "Phosphorylated on Ser-15 (H2BS14ph) by STK4/MST1 during apoptosis; which facilitates apoptotic chromatin condensation. Also phosphorylated on Ser-15 in response to DNA double strand breaks (DSBs), and in correlation with somatic hypermutation and immunoglobulin class-switch recombination. Phosphorylation at Ser-37 (H2BS36ph) by AMPK in response to stress promotes transcription (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q00715", "url": "https://www.uniprot.org/uniprot/Q00715" }, { "database": "PubMed", "id": "P33778", "url": "https://glygen.org/publication/PubMed/P33778" }, { "database": "PubMed", "id": "Q64475", "url": "https://glygen.org/publication/PubMed/Q64475" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }