{ "uniprot_canonical_ac": "P97884-1", "uniprot_ac": "P97884", "uniprot_id": "CCL20_RAT", "mass": { "chemical_mass": 10875.0, "monoisotopic_mass": 10875.0 }, "refseq": { "ac": "XP_006245226", "name": "C-C motif chemokine 20 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245226" }, "gene_names": [ { "name": "Ccl20", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P97884", "id": "P97884" }, { "name": "Ccl20", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245226", "id": "XP_006245226" }, { "name": "Scya20; ST38", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245226", "id": "XP_006245226" }, { "name": "Scya20", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P97884", "id": "P97884" }, { "name": "St38", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P97884", "id": "P97884" } ], "protein_names": [ { "name": "C-C motif chemokine 20", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P97884" }, { "name": "Beta-chemokine exodus-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "C-C motif chemokine 20 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245226", "id": "XP_006245226" }, { "name": "C-C motif chemokine 20 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106", "id": "NP_062106" }, { "name": "C-C motif chemokine 20; MIP-3-alpha; CC chemokine LARC; CC chemokine ST38; chemokine (C-C motif) ligand 20; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; beta-chemokine exodus-1; small inducible cytokine subfamily A20", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106", "id": "NP_062106" }, { "name": "CC chemokine LARC", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "CC chemokine ST38", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "Liver and activation-regulated chemokine", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "MIP-3-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "Macrophage inflammatory protein 3 alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" }, { "name": "Small-inducible cytokine A20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P97884" } ], "function": [ { "annotation": "Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the pro-inflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884#function" }, { "database": "UniProtKB", "id": "P78556", "url": "https://www.uniprot.org/uniprot/P78556#function" }, { "database": "UniProtKB", "id": "O89093", "url": "https://www.uniprot.org/uniprot/O89093#function" } ] }, { "annotation": "Ginkgolide B could alleviate MI/RI-induced inflammatory response through A20-NF-kappaB signal pathway, which may give us new insights into the preventive strategies for myocardial ischemia/reperfusion injury disease. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062106", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106" }, { "database": "PubMed", "id": "30619251", "url": "https://glygen.org/publication/PubMed/30619251" } ] }, { "annotation": "The results suggest a potential mechanism for the recruitment of IL-17-producing cells to degenerated intervertebral discs via a CCL20/CCR6 axis in vivo.", "evidence": [ { "database": "RefSeq", "id": "NP_062106", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106" }, { "database": "PubMed", "id": "26704184", "url": "https://glygen.org/publication/PubMed/26704184" } ] } ], "disease": [ { "disease_id": "DOID:0050486", "recommended_name": { "id": "DOID:0050486", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050486", "name": "exanthem", "description": "A skin disease that is characterized by a rash that results from a variety of causes including bacteria, viruses, toxins, drugs and autoimmune disorders." }, "synonyms": [], "evidence": [ { "id": "0050486", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050486" } ] }, { "disease_id": "DOID:0060061", "recommended_name": { "id": "DOID:0060061", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060061", "name": "primary cutaneous T-cell non-Hodgkin lymphoma", "description": "A non-Hodgkin's lymphoma that has_material_basis_in a mutation of T cells." }, "synonyms": [ { "id": "DOID:0060061", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060061", "name": "cutaneous T cell lymphoma", "description": "" }, { "id": "DOID:0060061", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060061", "name": "cutaneous T-cell lymphoma", "description": "" } ], "evidence": [ { "id": "0060061", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060061" } ] }, { "disease_id": "DOID:11168", "recommended_name": { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "anogenital venereal wart", "description": "A viral infectious disease that results_in infection located_in skin of vagina, cervix, uterus, anus, penis, scrotum, mouth, or throat, has_material_basis_in human papillomaviruses (types 6 and 11), which are transmitted_by direct contact with the skin during oral, genital, or anal sex with an infected partner. The infection has_symptom anogenital warts." }, "synonyms": [ { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Anogenital warts", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Genital warts", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Anogenital Human papilloma Virus Infectious Disease", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "genital wart virus infectious disease", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "venereal wart", "description": "" } ], "evidence": [ { "id": "11168", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11168" } ] }, { "disease_id": "DOID:11729", "recommended_name": { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "Lyme disease", "description": "A primary bacterial infectious disease that results_in infection, has_material_basis_in Borrelia burgdorferi, which is transmitted_by blacklegged tick (Ixodes scapularis) or transmitted_by western blacklegged tick (Ixodes pacificus). The infection has_symptom fever, has_symptom headache, has_symptom fatigue, and has_symptom skin rash called erythema migrans. If left untreated, infection can spread to joints, the heart, and the nervous system." }, "synonyms": [ { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "Bannwarth syndrome", "description": "" }, { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "Bannworth's syndrome", "description": "" }, { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "Lyme borreliosis", "description": "" }, { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "Neurological Lyme disease", "description": "" }, { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "lyme neuroborreliosis", "description": "" }, { "id": "DOID:11729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11729", "name": "neuroborreliosis", "description": "" } ], "evidence": [ { "id": "11729", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11729" } ] }, { "disease_id": "DOID:1564", "recommended_name": { "id": "DOID:1564", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1564", "name": "fungal infectious disease", "description": "A disease by infectious agent that results_in infection, has_material_basis_in Fungi, which pass the resistance barriers of the human or animal body." }, "synonyms": [ { "id": "DOID:1564", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1564", "name": "mycosis", "description": "" } ], "evidence": [ { "id": "1564", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1564" } ] }, { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ], "evidence": [ { "id": "1793", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1793" } ] }, { "disease_id": "DOID:224", "recommended_name": { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient cerebral ischemia", "description": "A brain ischemia that is characterized by ischemia of brief duration and without resultant tissue death." }, "synonyms": [ { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA - Transient ischaemic attack", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischaemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient ischemic attacks", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient ischemic attack", "description": "" } ], "evidence": [ { "id": "224", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:224" } ] }, { "disease_id": "DOID:2316", "recommended_name": { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "brain ischemia", "description": "An ischemia that is characterized by insufficient blood flow to the brain to meet metabolic demand." }, "synonyms": [ { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischaemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "cerebral ischemia", "description": "" } ], "evidence": [ { "id": "2316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2316" } ] }, { "disease_id": "DOID:2722", "recommended_name": { "id": "DOID:2722", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2722", "name": "acrodermatitis", "description": "A dermatitis that selectively affects the hands and feet." }, "synonyms": [], "evidence": [ { "id": "2722", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2722" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] }, { "disease_id": "DOID:2986", "recommended_name": { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "IgA glomerulonephritis", "description": "A glomerulonephritis characterized by build up of IgA antibody in the glomerulus." }, "synonyms": [ { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "Berger's IgA or IgG nephropathy", "description": "" }, { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "Focal Glomerulonephritis", "description": "" }, { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "IgA nephropathy", "description": "" }, { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "primary IgA nephropathy", "description": "" }, { "id": "DOID:2986", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2986", "name": "segmental glomerulonephritis", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "IgA nephropathy, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "IGAN1", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "IgA nephropathy, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "Igan", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "berger disease", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "glomerulonephritis, IgA", "description": "" }, { "id": "MONDO:0008072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008072", "name": "nephritis, IgA type", "description": "" } ], "evidence": [ { "id": "2986", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2986" } ] }, { "disease_id": "DOID:3178", "recommended_name": { "id": "DOID:3178", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3178", "name": "skin papilloma", "description": "A skin benign neoplasm that is composed of epithelial cells and a fibrous stalk." }, "synonyms": [ { "id": "DOID:3178", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3178", "name": "cutaneous papilloma", "description": "" }, { "id": "DOID:3178", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3178", "name": "papilloma of skin", "description": "" } ], "evidence": [ { "id": "3178", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3178" } ] }, { "disease_id": "DOID:3310", "recommended_name": { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "atopic dermatitis", "description": "An allergic contact dermatitis that is a chronically relapsing inflammatory allergic response located_in the skin that causes itching and flaking." }, "synonyms": [ { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "Atopic neurodermatitis", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "Besnier's prurigo", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "allergic dermatitis", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "atopic eczema", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "dermatitis, atopic", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "ATOD", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "dermatitis, atopic", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "eczema, atopic", "description": "" } ], "evidence": [ { "id": "3310", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3310" } ] }, { "disease_id": "DOID:418", "recommended_name": { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "systemic scleroderma", "description": "A scleroderma that is characterized by fibrosis (or hardening) of the skin and major organs, as well as vascular alterations, and autoantibodies." }, "synonyms": [ { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "Scleroderma", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "Scleroderma syndrome", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "progressive systemic sclerosis", "description": "" }, { "id": "DOID:418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:418", "name": "systemic sclerosis", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "scleroderma, familial progressive", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "scleroderma, familial progressive", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "Crest syndrome", "description": "" }, { "id": "MONDO:0008418", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008418", "name": "systemic sclerosis, susceptibility to", "description": "" } ], "evidence": [ { "id": "418", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:418" } ] }, { "disease_id": "DOID:8577", "recommended_name": { "id": "DOID:8577", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8577", "name": "ulcerative colitis", "description": "A colitis that is predominantly confined to the mucosa located_in colon and includes characteristic ulcers, or open sores." }, "synonyms": [ { "id": "DOID:8577", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8577", "name": "Left-sided ulcerative colitis", "description": "" } ], "evidence": [ { "id": "8577", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8577" } ] }, { "disease_id": "DOID:8893", "recommended_name": { "id": "DOID:8893", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8893", "name": "psoriasis", "description": "A skin disease that is characterized by patches of thick red skin and silvery scales." }, "synonyms": [ { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "psoriasis 1, susceptibility to", "description": "Any psoriasis in which the cause of the disease is a mutation in the HLA-C gene." }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "HLA-C psoriasis", "description": "" }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "psoriasis 1, susceptibility to", "description": "" }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "psoriasis caused by mutation in HLA-C", "description": "" }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "psoriasis susceptibility 1", "description": "" }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "PSORS1", "description": "" }, { "id": "MONDO:0008334", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008334", "name": "susceptibility to psoriasis 1", "description": "" }, { "id": "MIM:177900", "resource": "MIM", "url": "https://www.omim.org/entry/177900", "name": "Psoriasis 1", "description": "Psoriasis 1" } ], "evidence": [ { "id": "8893", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8893" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ccl20", "url": "https://www.uniprot.org/uniprot/P97884", "locus": { "chromosome": "9", "start_pos": 84391629, "end_pos": 84388904, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000015992", "url": "https://www.ensembl.org/id/ENSRNOG00000015992" } ] } } ], "crossref": [ { "id": "ENSRNOG00000015992", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000015992", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01119", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01119", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "29538", "url": "https://www.ncbi.nlm.nih.gov/gene/29538", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034133", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034133", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:29538", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29538", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MCGSKSL", "url": "https://omabrowser.org/oma/group/MCGSKSL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5353157at2759", "url": "http://www.orthodb.org/?query=5353157at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015:SF108", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015:SF108", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00048", "url": "http://pfam.xfam.org/family/PF00048", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P97884", "url": "http://purl.obolibrary.org/obo/PR_P97884", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-380108", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062106", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "3646", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=3646", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8L2QAZ9", "url": "https://www.uniprot.org/uniprot/A0A8L2QAZ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QAZ9-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QAZ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P97884-1", "url": "https://www.uniprot.org/uniprot/P97884-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM", "length": 96, "header": "sp|P97884-1|CCL20_RAT Isoform 1 of C-C motif chemokine 20 OS=Rattus norvegicus OX=10116 GN=Ccl20 PE=1 SV=1 CANONICAL=P97884-1" }, "isoforms": [ { "isoform_ac": "A0A8L2QAZ9-1", "url": "", "sequence": { "sequence": "MACKHLPFLALAGVLLAYLCSQSEASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM", "length": 95, "header": "tr|A0A8L2QAZ9-1|A0A8L2QAZ9_RAT Computationally mapped isoform of C-C motif chemokine ligand 20 OS=Rattus norvegicus OX=10116 GN=Ccl20 PE=4 SV=1 CANONICAL=P97884-1" }, "locus": { "chromosome": "9", "start_pos": 84391172, "end_pos": 84389103, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000021730.4", "url": "https://www.ensembl.org/id/ENSRNOT00000021730.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000021730.2", "url": "https://www.ensembl.org/id/ENSRNOP00000021730.2" } ] } }, { "isoform_ac": "P97884-1", "url": "", "sequence": { "sequence": "MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM", "length": 96, "header": "sp|P97884-1|CCL20_RAT Isoform 1 of C-C motif chemokine 20 OS=Rattus norvegicus OX=10116 GN=Ccl20 PE=1 SV=1 CANONICAL=P97884-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Production of CCL20 on nucleus pulposus cells recruits IL-17-producing cells to degenerated IVD tissues in rat models.", "journal": "Journal of molecular histology", "date": "2016", "authors": "Zhang Y, Liu L, Wang S, Zhao Y, Liu Y, Li J, Nie L, Cheng L", "evidence": [ { "database": "RefSeq", "id": "NP_062106", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106" } ], "reference": [ { "type": "PubMed", "id": "26704184", "url": "https://glygen.org/publication/PubMed/26704184" } ] }, { "title": "Cardioprotection of Ginkgolide B on Myocardial Ischemia/Reperfusion-Induced Inflammatory Injury via Regulation of A20-NF-kappaB Pathway.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Zhang R, Xu L, Zhang D, Hu B, Luo Q, Han D, Li J, Shen C", "evidence": [ { "database": "RefSeq", "id": "NP_062106", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062106" } ], "reference": [ { "type": "PubMed", "id": "30619251", "url": "https://glygen.org/publication/PubMed/30619251" } ] }, { "title": "A novel rat CC chemokine, identified by targeted differential display, is upregulated in brain inflammation.", "journal": "J. Neuroimmunol.", "date": "1998", "authors": "Utans-Schneitz U, Lorez H, Klinkert WE, da Silva J, Lesslauer W", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "reference": [ { "type": "PubMed", "id": "9916893", "url": "https://glygen.org/publication/PubMed/9916893" } ] } ], "pathway": [ { "id": "rno:29538", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29538", "resource": "KEGG Pathway" }, { "id": "R-RNO-380108", "name": "Chemokine receptors bind chemokines", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-380108", "resource": "Reactome", "description": "Chemokine receptors bind chemokines" }, { "id": "R-RNO-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "O89093-1", "protein_name": "C-C motif chemokine 20", "gene_name": "Ccl20", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MACGGKRLLFLALAWVLLAHLCSQAEAASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM", "length": 97 }, "evidence": [ { "id": "45230854", "url": "http://www.informatics.jax.org/homology/45230854", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P78556-1", "protein_name": "C-C motif chemokine 20", "gene_name": "CCL20", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM", "length": 96 }, "evidence": [ { "id": "45230854", "url": "http://www.informatics.jax.org/homology/45230854", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 23, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 alpha production", "id": "GO:0032730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032730", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "chemokine-mediated signaling pathway", "id": "GO:0070098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070098", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "positive regulation of T cell migration", "id": "GO:2000406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000406", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "lymphocyte chemotaxis", "id": "GO:0048247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048247", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to organic substance", "id": "GO:0071310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071310", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "calcium-mediated signaling using intracellular calcium source", "id": "GO:0035584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035584", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "monocyte chemotaxis", "id": "GO:0002548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002548", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to interleukin-1", "id": "GO:0071347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071347", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "T cell migration", "id": "GO:0072678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072678", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "thymocyte migration", "id": "GO:0072679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072679", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cellular response to lipoteichoic acid", "id": "GO:0071223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071223", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "neutrophil chemotaxis", "id": "GO:0030593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "positive regulation of nitric-oxide synthase biosynthetic process", "id": "GO:0051770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051770", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "chemokine activity", "id": "GO:0008009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008009", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "CCR chemokine receptor binding", "id": "GO:0048020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048020", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" }, { "name": "CCR6 chemokine receptor binding", "id": "GO:0031731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031731", "evidence": [ { "database": "UniProtKB", "id": "P97884", "url": "https://www.uniprot.org/uniprot/P97884" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }