{ "uniprot_canonical_ac": "P97784-1", "uniprot_ac": "P97784", "uniprot_id": "CRY1_MOUSE", "mass": { "chemical_mass": 68001.0, "monoisotopic_mass": 68001.0 }, "refseq": { "ac": "NP_031797", "name": "cryptochrome-1", "summary": "This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of this gene results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Feb 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797" }, "gene_names": [ { "name": "Cry1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P97784", "id": "P97784" }, { "name": "Cry1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797", "id": "NP_031797" }, { "name": "Phll1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797", "id": "NP_031797" } ], "protein_names": [ { "name": "Cryptochrome-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P97784" }, { "name": "cryptochrome 1 (photolyase-like)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797", "id": "NP_031797" }, { "name": "cryptochrome-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797", "id": "NP_031797" } ], "function": [ { "annotation": "The duper mutation reveals previously unsuspected functions of Cryptochrome 1 in circadian entrainment and heart disease.", "evidence": [ { "database": "RefSeq", "id": "NP_031797", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797" }, { "database": "PubMed", "id": "35930669", "url": "https://glygen.org/publication/PubMed/35930669" } ] }, { "annotation": "This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of this gene results in a shortened circadian cycle in complete darkness. [provided by RefSeq, Feb 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_031797", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797" } ] }, { "annotation": "Transcriptional repressor which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, BMAL1, BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and BMAL1 or BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-BMAL1|BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1/2 and RORA/B/G, which form a second feedback loop and which activate and repress BMAL1 transcription, respectively. CRY1 and CRY2 have redundant functions but also differential and selective contributions at least in defining the pace of the SCN circadian clock and its circadian transcriptional outputs. More potent transcriptional repressor in cerebellum and liver than CRY2, though more effective in lengthening the period of the SCN oscillator. On its side, CRY2 seems to play a critical role in tuning SCN circadian period by opposing the action of CRY1. With CRY2, is dispensable for circadian rhythm generation but necessary for the development of intercellular networks for rhythm synchrony. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. Interacts with CLOCK-BMAL1 independently of PER proteins and is found at CLOCK-BMAL1-bound sites, suggesting that CRY may act as a molecular gatekeeper to maintain CLOCK-BMAL1 in a poised and repressed state until the proper time for transcriptional activation. Represses the CLOCK-BMAL1 induced transcription of BHLHE40/DEC1, ATF4, MTA1, KLF10 and NAMPT. May repress circadian target genes expression in collaboration with HDAC1 and HDAC2 through histone deacetylation. Mediates the clock-control activation of ATR and modulates ATR-mediated DNA damage checkpoint. In liver, mediates circadian regulation of cAMP signaling and gluconeogenesis by binding to membrane-coupled G proteins and blocking glucagon-mediated increases in intracellular cAMP concentrations and CREB1 phosphorylation. Inhibits hepatic gluconeogenesis by decreasing nuclear FOXO1 levels that down-regulates gluconeogenic gene expression. Besides its role in the maintenance of the circadian clock, is also involved in the regulation of other processes. Represses glucocorticoid receptor NR3C1/GR-induced transcriptional activity by binding to glucocorticoid response elements (GREs). Plays a key role in glucose and lipid metabolism modulation, in part, through the transcriptional regulation of genes involved in these pathways, such as LEP or ACSL4. Represses PPARD and its target genes in the skeletal muscle and limits exercise capacity (PubMed:28683290). Plays an essential role in the generation of circadian rhythms in the retina (PubMed:29561690). Represses the transcriptional activity of NR1I2 (PubMed:28751364).", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784#function" }, { "database": "PubMed", "id": "21236481", "url": "https://glygen.org/publication/PubMed/21236481" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" }, { "database": "PubMed", "id": "24089055", "url": "https://glygen.org/publication/PubMed/24089055" }, { "database": "PubMed", "id": "24489120", "url": "https://glygen.org/publication/PubMed/24489120" }, { "database": "PubMed", "id": "20852621", "url": "https://glygen.org/publication/PubMed/20852621" }, { "database": "PubMed", "id": "19129230", "url": "https://glygen.org/publication/PubMed/19129230" }, { "database": "PubMed", "id": "16628007", "url": "https://glygen.org/publication/PubMed/16628007" }, { "database": "PubMed", "id": "24378737", "url": "https://glygen.org/publication/PubMed/24378737" }, { "database": "PubMed", "id": "17310242", "url": "https://glygen.org/publication/PubMed/17310242" }, { "database": "PubMed", "id": "23575670", "url": "https://glygen.org/publication/PubMed/23575670" }, { "database": "PubMed", "id": "23133559", "url": "https://glygen.org/publication/PubMed/23133559" }, { "database": "PubMed", "id": "23531614", "url": "https://glygen.org/publication/PubMed/23531614" }, { "database": "PubMed", "id": "22170608", "url": "https://glygen.org/publication/PubMed/22170608" }, { "database": "PubMed", "id": "19299583", "url": "https://glygen.org/publication/PubMed/19299583" }, { "database": "PubMed", "id": "26431207", "url": "https://glygen.org/publication/PubMed/26431207" }, { "database": "PubMed", "id": "28790135", "url": "https://glygen.org/publication/PubMed/28790135" }, { "database": "PubMed", "id": "28751364", "url": "https://glygen.org/publication/PubMed/28751364" }, { "database": "PubMed", "id": "15226430", "url": "https://glygen.org/publication/PubMed/15226430" }, { "database": "PubMed", "id": "28683290", "url": "https://glygen.org/publication/PubMed/28683290" }, { "database": "PubMed", "id": "10428031", "url": "https://glygen.org/publication/PubMed/10428031" }, { "database": "PubMed", "id": "16478995", "url": "https://glygen.org/publication/PubMed/16478995" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" }, { "database": "PubMed", "id": "29561690", "url": "https://glygen.org/publication/PubMed/29561690" }, { "database": "PubMed", "id": "24385426", "url": "https://glygen.org/publication/PubMed/24385426" }, { "database": "PubMed", "id": "21768648", "url": "https://glygen.org/publication/PubMed/21768648" }, { "database": "PubMed", "id": "20385766", "url": "https://glygen.org/publication/PubMed/20385766" }, { "database": "PubMed", "id": "23616524", "url": "https://glygen.org/publication/PubMed/23616524" } ] } ], "disease": [ { "disease_id": "DOID:0111141", "recommended_name": { "id": "DOID:0111141", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111141", "name": "delayed sleep phase syndrome", "description": "A sleep disorder characterized by an extreme evening preference, sleep-onset insomnia, and difficulty in awakening at the desired time." }, "synonyms": [ { "id": "DOID:0111141", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111141", "name": "DSPD", "description": "" } ], "evidence": [ { "id": "0111141", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111141" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "K", "sequence_mut": "R", "comment": "Sensitive to FBXL3-ediated degradation but noz affected by expression of FBXL21.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23452856", "url": "https://glygen.org/publication/PubMed/23452856" } ] }, { "start_pos": 224, "end_pos": 224, "sequence_org": "H", "sequence_mut": "E", "comment": "Reduces affinity for FBXL3.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "start_pos": 247, "end_pos": 247, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced MAPK-catalyzed in vitro phosphorylation. No effect on inhibition of CLOCK-BMAL1-mediated transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" }, { "database": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" } ] }, { "start_pos": 247, "end_pos": 247, "sequence_org": "S", "sequence_mut": "D", "comment": "Reduced inhibition of CLOCK-BMAL1-mediated transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" }, { "database": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" } ] }, { "start_pos": 273, "end_pos": 273, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduced interaction with MAP1LC3B and significant decrease in its autophagy-mediated degradation; when associated with A-276.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 276, "end_pos": 276, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduced interaction with MAP1LC3B and significant decrease in its autophagy-mediated degradation; when associated with A-273.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 280, "end_pos": 280, "sequence_org": "S", "sequence_mut": "A", "comment": "Phosphomimetic mutant that leads to stabilization of the protein; when associated with A-71.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ] }, { "start_pos": 280, "end_pos": 280, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that leads to destabilization of the protein and abolishes ability to bind PER2; when associated with D-71.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ] }, { "start_pos": 287, "end_pos": 287, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on its interaction with MAP1LC3B and moderate decrease in its autophagy-mediated degradation; when associated with A-290.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 290, "end_pos": 290, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on its interaction with MAP1LC3B and moderate decrease in its autophagy-mediated degradation; when associated with A-287.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 336, "end_pos": 336, "sequence_org": "G", "sequence_mut": "D", "comment": "Abolishes transcriptional repression of target genes. Abolishes interaction with PER2.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ] }, { "start_pos": 382, "end_pos": 383, "sequence_org": "EE", "sequence_mut": "RR", "comment": "Decreases transcriptional repression of target genes. Decreases FBXL3 binding. Increases PER2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "start_pos": 405, "end_pos": 405, "sequence_org": "F", "sequence_mut": "A", "comment": "Decreases affinity for FBXL3. Slightly increases affinity for PER2.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "start_pos": 485, "end_pos": 485, "sequence_org": "K", "sequence_mut": "D", "comment": "Strongly reduces FBXL3 binding. Reduces PER2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "start_pos": 485, "end_pos": 485, "sequence_org": "K", "sequence_mut": "E", "comment": "Strongly reduces FBXL3 binding. Reduces PER2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "start_pos": 488, "end_pos": 488, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on its interaction with MAP1LC3B and moderate decrease in its autophagy-mediated degradation; when associated with A-491.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 491, "end_pos": 491, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on its interaction with MAP1LC3B and moderate decrease in its autophagy-mediated degradation; when associated with A-488.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 494, "end_pos": 494, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of interaction with MAP1LC3B and significant decrease in its autophagy-mediated degradation; when associated with A-497.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 497, "end_pos": 497, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of interaction with MAP1LC3B and significant decrease in its autophagy-mediated degradation; when associated with A-494.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "start_pos": 551, "end_pos": 551, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on circadian period length and protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 551, "end_pos": 551, "sequence_org": "S", "sequence_mut": "D", "comment": "No effect on circadian period length and protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 564, "end_pos": 564, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on circadian period length and protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 564, "end_pos": 564, "sequence_org": "S", "sequence_mut": "D", "comment": "No effect on circadian period length and protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 585, "end_pos": 585, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of ubiquitination. No loss of interaction with DDB1-CUL4A complex.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "26431207", "url": "https://glygen.org/publication/PubMed/26431207" } ] }, { "start_pos": 588, "end_pos": 588, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on circadian period length and protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 588, "end_pos": 588, "sequence_org": "S", "sequence_mut": "D", "comment": "Lengthen circadian period. No effect on repressive activity. Increases protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "start_pos": 71, "end_pos": 71, "sequence_org": "S", "sequence_mut": "A", "comment": "Phosphomimetic mutant that leads to stabilization of the protein; when associated with A-280.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ] }, { "start_pos": 71, "end_pos": 71, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that leads to destabilization of the protein and abolishes ability to bind PER2; when associated with D-280.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cry1", "url": "https://www.uniprot.org/uniprot/P97784", "locus": { "chromosome": "10", "start_pos": 84967564, "end_pos": 85020928, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020038", "url": "https://www.ensembl.org/id/ENSMUSG00000020038" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020038", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020038", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "12952", "url": "https://www.ncbi.nlm.nih.gov/gene/12952", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P97784", "url": "https://www.ebi.ac.uk/intact/interactors/id:P97784*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002081", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002081", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005101", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005101", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006050", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006050", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014729", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014729", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12952", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12952", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1270841", "url": "http://www.informatics.jax.org/marker/MGI:1270841", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WQQELAW", "url": "https://omabrowser.org/oma/group/WQQELAW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "124765at2759", "url": "http://www.orthodb.org/?query=124765at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11455", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11455", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11455:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11455:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4CT0", "url": "https://www.rcsb.org/structure/4CT0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K0R", "url": "https://www.rcsb.org/structure/4K0R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T5X", "url": "https://www.rcsb.org/structure/5T5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KX4", "url": "https://www.rcsb.org/structure/6KX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KX5", "url": "https://www.rcsb.org/structure/6KX5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KX6", "url": "https://www.rcsb.org/structure/6KX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KX7", "url": "https://www.rcsb.org/structure/6KX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LUE", "url": "https://www.rcsb.org/structure/6LUE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OF7", "url": "https://www.rcsb.org/structure/6OF7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D0M", "url": "https://www.rcsb.org/structure/7D0M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D19", "url": "https://www.rcsb.org/structure/7D19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D1C", "url": "https://www.rcsb.org/structure/7D1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DLI", "url": "https://www.rcsb.org/structure/7DLI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WVA", "url": "https://www.rcsb.org/structure/7WVA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00875", "url": "http://pfam.xfam.org/family/PF00875", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03441", "url": "http://pfam.xfam.org/family/PF03441", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P97784", "url": "http://purl.obolibrary.org/obo/PR_P97784", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_031797", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1L1SUT8", "url": "https://www.uniprot.org/uniprot/A0A1L1SUT8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1SUT8-1", "url": "https://www.uniprot.org/uniprot/A0A1L1SUT8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P97784-1", "url": "https://www.uniprot.org/uniprot/P97784-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN", "length": 606, "header": "sp|P97784-1|CRY1_MOUSE Isoform 1 of Cryptochrome-1 OS=Mus musculus OX=10090 GN=Cry1 PE=1 SV=1 CANONICAL=P97784-1" }, "isoforms": [ { "isoform_ac": "A0A1L1SUT8-1", "url": "", "sequence": { "sequence": "XGKERDAAIKKLATEAGVEVIVRISHTLIIELNGGQPPLTYKRFQTLVSKMEPLEMPAD", "length": 59, "header": "tr|A0A1L1SUT8-1|A0A1L1SUT8_MOUSE Computationally mapped isoform of Cryptochrome 1 (photolyase-like) OS=Mus musculus OX=10090 GN=Cry1 PE=4 SV=1 CANONICAL=P97784-1" }, "locus": { "chromosome": "10", "start_pos": 84987172, "end_pos": 84984567, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000214675.2", "url": "https://www.ensembl.org/id/ENSMUST00000214675.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000150910.2", "url": "https://www.ensembl.org/id/ENSMUSP00000150910.2" } ] } }, { "isoform_ac": "P97784-1", "url": "", "sequence": { "sequence": "MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN", "length": 606, "header": "sp|P97784-1|CRY1_MOUSE Isoform 1 of Cryptochrome-1 OS=Mus musculus OX=10090 GN=Cry1 PE=1 SV=1 CANONICAL=P97784-1" }, "locus": { "chromosome": "10", "start_pos": 85020335, "end_pos": 84968922, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020227", "url": "https://www.ensembl.org/id/ENSMUST00000020227" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020227", "url": "https://www.ensembl.org/id/ENSMUSP00000020227" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "P63085-1", "kinase_gene_name": "Mapk1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P97784", "url": "http://phospho.elm.eu.org/byAccession/P97784.html" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" }, { "database": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" } ], "site_lbl": "Ser247" }, { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" }, { "database": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" } ], "site_lbl": "Ser247" }, { "start_pos": 280, "end_pos": 280, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ], "site_lbl": "Ser280" }, { "start_pos": 588, "end_pos": 588, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" } ], "site_lbl": "Ser588" }, { "start_pos": 71, "end_pos": 71, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" }, { "database": "PubMed", "id": "31258021", "url": "https://glygen.org/publication/PubMed/31258021" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ], "site_lbl": "Ser71" } ], "glycation": [], "keywords": [], "publication": [ { "title": "mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop.", "journal": "Cell", "date": "1999", "authors": "Kume K, Zylka MJ, Sriram S, Shearman LP, Weaver DR, Jin X, Maywood ES, Hastings MH, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "10428031", "url": "https://glygen.org/publication/PubMed/10428031" } ] }, { "title": "Circadian regulation of cryptochrome genes in the mouse.", "journal": "Brain Res. Mol. Brain Res.", "date": "1999", "authors": "Miyamoto Y, Sancar A", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "10521578", "url": "https://glygen.org/publication/PubMed/10521578" } ] }, { "title": "Posttranslational mechanisms regulate the mammalian circadian clock.", "journal": "Cell", "date": "2001", "authors": "Lee C, Etchegaray JP, Cagampang FR, Loudon AS, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "11779462", "url": "https://glygen.org/publication/PubMed/11779462" } ] }, { "title": "The circadian regulatory proteins BMAL1 and cryptochromes are substrates of casein kinase Iepsilon.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Eide EJ, Vielhaber EL, Hinz WA, Virshup DM", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "11875063", "url": "https://glygen.org/publication/PubMed/11875063" } ] }, { "title": "Nucleocytoplasmic shuttling and mCRY-dependent inhibition of ubiquitylation of the mPER2 clock protein.", "journal": "EMBO J.", "date": "2002", "authors": "Yagita K, Tamanini F, Yasuda M, Hoeijmakers JH, van der Horst GT, Okamura H", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "11889036", "url": "https://glygen.org/publication/PubMed/11889036" } ] }, { "title": "Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Lee C, Weaver DR, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "14701732", "url": "https://glygen.org/publication/PubMed/14701732" } ] }, { "title": "Circadian and light-induced transcription of clock gene Per1 depends on histone acetylation and deacetylation.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Tanaka M., Yoshioka H., Iijima N., Naruse M., Naruse Y., Oh-hashi K.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "15226430", "url": "https://glygen.org/publication/PubMed/15226430" } ] }, { "title": "Serine phosphorylation of mCRY1 and mCRY2 by mitogen-activated protein kinase.", "journal": "Genes Cells", "date": "2004", "authors": "Sanada K, Harada Y, Sakai M, Todo T, Fukada Y", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" } ], "reference": [ { "type": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" } ] }, { "title": "Functional evolution of the photolyase/cryptochrome protein family: importance of the C terminus of mammalian CRY1 for circadian core oscillator performance.", "journal": "Mol. Cell. Biol.", "date": "2006", "authors": "van der Horst G.T.J., Yagita K., Okamura H., Tamanini F., Barnhoorn S., Chaves I.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "16478995", "url": "https://glygen.org/publication/PubMed/16478995" } ] }, { "title": "Post-translational regulation of circadian transcriptional CLOCK(NPAS2)/BMAL1 complex by CRYPTOCHROMES.", "journal": "Cell Cycle", "date": "2006", "authors": "Kondratov RV, Kondratova AA, Lee C, Gorbacheva VY, Chernov MV, Antoch MP", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "16628007", "url": "https://glygen.org/publication/PubMed/16628007" } ] }, { "title": "The polycomb group protein EZH2 is required for mammalian circadian clock function.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Yang X., Jenuwein T., DeBruyne J.P., Etchegaray J.P., Peters A.H., Reppert S.M., Weaver D.R.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "16717091", "url": "https://glygen.org/publication/PubMed/16717091" } ] }, { "title": "Posttranslational regulation of the mammalian circadian clock by cryptochrome and protein phosphatase 5.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Partch CL, Shields KF, Thompson CL, Selby CP, Sancar A", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "16790549", "url": "https://glygen.org/publication/PubMed/16790549" } ] }, { "title": "CIPC is a mammalian circadian clock protein without invertebrate homologues.", "journal": "Nat. Cell Biol.", "date": "2007", "authors": "Zhao WN, Malinin N, Yang FC, Staknis D, Gekakis N, Maier B, Reischl S, Kramer A, Weitz CJ", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "17310242", "url": "https://glygen.org/publication/PubMed/17310242" } ] }, { "title": "Circadian mutant Overtime reveals F-box protein FBXL3 regulation of cryptochrome and period gene expression.", "journal": "Cell", "date": "2007", "authors": "Siepka SM, Yoo SH, Park J, Song W, Kumar V, Hu Y, Lee C, Takahashi JS", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "17462724", "url": "https://glygen.org/publication/PubMed/17462724" } ] }, { "title": "Implication of the F-Box Protein FBXL21 in circadian pacemaker function in mammals.", "journal": "PLoS ONE", "date": "2008", "authors": "Dardente H, Mendoza J, Fustin JM, Challet E, Hazlerigg DG", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "18953409", "url": "https://glygen.org/publication/PubMed/18953409" } ] }, { "title": "Molecular characterization of Mybbp1a as a co-repressor on the Period2 promoter.", "journal": "Nucleic Acids Res.", "date": "2009", "authors": "Miyazaki K., Hara Y., Fukamizu A., Ishida N., Onishi Y., Oishi K.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "19129230", "url": "https://glygen.org/publication/PubMed/19129230" } ] }, { "title": "Circadian clock feedback cycle through NAMPT-mediated NAD+ biosynthesis.", "journal": "Science", "date": "2009", "authors": "Ramsey KM, Yoshino J, Brace CS, Abrassart D, Kobayashi Y, Marcheva B, Hong HK, Chong JL, Buhr ED, Lee C, Takahashi JS, Imai S, Bass J", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "19299583", "url": "https://glygen.org/publication/PubMed/19299583" } ] }, { "title": "AMPK regulates the circadian clock by cryptochrome phosphorylation and degradation.", "journal": "Science", "date": "2009", "authors": "Lamia KA, Sachdeva UM, DiTacchio L, Williams EC, Alvarez JG, Egan DF, Vasquez DS, Juguilon H, Panda S, Shaw RJ, Thompson CB, Evans RM", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" } ], "reference": [ { "type": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" } ] }, { "title": "Rhythmic PER abundance defines a critical nodal point for negative feedback within the circadian clock mechanism.", "journal": "Mol. Cell", "date": "2009", "authors": "Chen R., Lee H., Kumar V., Lee Y., Lee C., Takahashi J.S., Yoo S.H., Schirmer A.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "19917250", "url": "https://glygen.org/publication/PubMed/19917250" } ] }, { "title": "The mammalian clock component PERIOD2 coordinates circadian output by interaction with nuclear receptors.", "journal": "Genes Dev.", "date": "2010", "authors": "Schmutz I, Ripperger JA, Baeriswyl-Aebischer S, Albrecht U", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "20159955", "url": "https://glygen.org/publication/PubMed/20159955" } ] }, { "title": "Kruppel-like factor KLF10 is a link between the circadian clock and metabolism in liver.", "journal": "Mol. Cell. Biol.", "date": "2010", "authors": "Spelsberg T.C., Subramaniam M., Staels B., Fievet C., Brangolo S., Delaunay F., Grechez-Cassiau A., Guillaumond F., Peteri-Brunback B., Teboul M.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "20385766", "url": "https://glygen.org/publication/PubMed/20385766" } ] }, { "title": "Cryptochrome mediates circadian regulation of cAMP signaling and hepatic gluconeogenesis.", "journal": "Nat. Med.", "date": "2010", "authors": "Zhang EE, Liu Y, Dentin R, Pongsawakul PY, Liu AC, Hirota T, Nusinow DA, Sun X, Landais S, Kodama Y, Brenner DA, Montminy M, Kay SA", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "20852621", "url": "https://glygen.org/publication/PubMed/20852621" } ] }, { "title": "Delay in feedback repression by cryptochrome 1 is required for circadian clock function.", "journal": "Cell", "date": "2011", "authors": "Xu H., Ueda H.R., Yamada R.G., Liu A.C., Ripperger J.A., Ukai-Tadenuma M.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "21236481", "url": "https://glygen.org/publication/PubMed/21236481" } ] }, { "title": "Biochemical analysis of the canonical model for the mammalian circadian clock.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Ye R., Annayev Y., Sancar A., Ozturk N., Selby C.P.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "21613214", "url": "https://glygen.org/publication/PubMed/21613214" } ] }, { "title": "cAMP-response element (CRE)-mediated transcription by activating transcription factor-4 (ATF4) is essential for circadian expression of the Period2 gene.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Okamoto A., Matsunaga N., Hamdan A.M., Horiguchi M., Koyanagi S., Kusunose N., Ohdo S.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "21768648", "url": "https://glygen.org/publication/PubMed/21768648" } ] }, { "title": "Cryptochromes mediate rhythmic repression of the glucocorticoid receptor.", "journal": "Nature", "date": "2011", "authors": "Barish G.D., Downes M., Evans R.M., Jonker J.W., Lamia K.A., Papp S.J., Uhlenhaut N.H., Yu R.T.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "22170608", "url": "https://glygen.org/publication/PubMed/22170608" } ] }, { "title": "Identification of small molecule activators of cryptochrome.", "journal": "Science", "date": "2012", "authors": "Hirota T, Lee JW, St John PC, Sawa M, Iwaisako K, Noguchi T, Pongsawakul PY, Sonntag T, Welsh DK, Brenner DA, Doyle FJ 3rd, Schultz PG, Kay SA", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "22798407", "url": "https://glygen.org/publication/PubMed/22798407" } ] }, { "title": "Role of type II protein arginine methyltransferase 5 in the regulation of Circadian Per1 gene.", "journal": "PLoS ONE", "date": "2012", "authors": "Lee K., Ju B.G., Lee J.W., Kim H.G., Cho S., Jeong H., Kim W.S., Na J., Na W., Shin J.Y.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23133559", "url": "https://glygen.org/publication/PubMed/23133559" } ] }, { "title": "Metabolism and the circadian clock converge.", "journal": "Physiol. Rev.", "date": "2013", "authors": "Sassone-Corsi P., Eckel-Mahan K.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23303907", "url": "https://glygen.org/publication/PubMed/23303907" } ] }, { "title": "Mammalian TIMELESS is involved in period determination and DNA damage-dependent phase advancing of the circadian clock.", "journal": "PLoS ONE", "date": "2013", "authors": "Engelen E, Janssens RC, Yagita K, Smits VA, van der Horst GT, Tamanini F", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23418588", "url": "https://glygen.org/publication/PubMed/23418588" } ] }, { "title": "Competing E3 ubiquitin ligases govern circadian periodicity by degradation of CRY in nucleus and cytoplasm.", "journal": "Cell", "date": "2013", "authors": "Yoo SH, Mohawk JA, Siepka SM, Shan Y, Huh SK, Hong HK, Kornblum I, Kumar V, Koike N, Xu M, Nussbaum J, Liu X, Chen Z, Chen ZJ, Green CB, Takahashi JS", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23452855", "url": "https://glygen.org/publication/PubMed/23452855" } ] }, { "title": "FBXL21 regulates oscillation of the circadian clock through ubiquitination and stabilization of cryptochromes.", "journal": "Cell", "date": "2013", "authors": "Hirano A, Yumimoto K, Tsunematsu R, Matsumoto M, Oyama M, Kozuka-Hata H, Nakagawa T, Lanjakornsiripan D, Nakayama KI, Fukada Y", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23452856", "url": "https://glygen.org/publication/PubMed/23452856" } ] }, { "title": "High-fat diet-induced hyperinsulinemia and tissue-specific insulin resistance in Cry-deficient mice.", "journal": "Am. J. Physiol.", "date": "2013", "authors": "van der Horst G.T., Barclay J.L., Johren O., Landgraf D., Leliavski A., Muller-Fielitz H., Naujokat N., Oster H., Shostak A., Tsang A.H.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23531614", "url": "https://glygen.org/publication/PubMed/23531614" } ] }, { "title": "Cryptochromes are critical for the development of coherent circadian rhythms in the mouse suprachiasmatic nucleus.", "journal": "Nat. Commun.", "date": "2013", "authors": "Honma K., Honma S., Ono D.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23575670", "url": "https://glygen.org/publication/PubMed/23575670" } ] }, { "title": "Distinct and separable roles for endogenous CRY1 and CRY2 within the circadian molecular clockwork of the suprachiasmatic nucleus, as revealed by the Fbxl3(Afh) mutation.", "journal": "J. Neurosci.", "date": "2013", "authors": "Nolan P.M., Chesham J.E., Hastings M.H., Maywood E.S., Anand S.N., Banks G.T., Joynson G.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23616524", "url": "https://glygen.org/publication/PubMed/23616524" } ] }, { "title": "Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.", "journal": "Cell", "date": "2013", "authors": "Czarna A, Berndt A, Singh HR, Grudziecki A, Ladurner AG, Timinszky G, Kramer A, Wolf E", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23746849", "url": "https://glygen.org/publication/PubMed/23746849" } ] }, { "title": "Molecular architecture of the mammalian circadian clock.", "journal": "Trends Cell Biol.", "date": "2014", "authors": "Takahashi J.S., Green C.B., Partch C.L.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "23916625", "url": "https://glygen.org/publication/PubMed/23916625" } ] }, { "title": "Metastasis-associated protein 1 is an integral component of the circadian molecular machinery.", "journal": "Nat. Commun.", "date": "2013", "authors": "Lee C.C., Kumar R., Peng S., Deng C.X., Balasenthil S., Li D.Q., Pakala S.B., Reddy S.D., Rea M.A.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "24089055", "url": "https://glygen.org/publication/PubMed/24089055" } ] }, { "title": "Phosphorylation of the cryptochrome 1 C-terminal tail regulates circadian period length.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gao P, Yoo SH, Lee KJ, Rosensweig C, Takahashi JS, Chen BP, Green CB", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" } ], "reference": [ { "type": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "title": "Modulation of glucocorticoid receptor induction properties by core circadian clock proteins.", "journal": "Mol. Cell. Endocrinol.", "date": "2014", "authors": "Kim K., Lee Y.J., Cho S., Han D.H., Kim C.J.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "24378737", "url": "https://glygen.org/publication/PubMed/24378737" } ] }, { "title": "Gene model 129 (Gm129) encodes a novel transcriptional repressor that modulates circadian gene expression.", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Annayev Y, Adar S, Chiou YY, Lieb JD, Sancar A, Ye R", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "24385426", "url": "https://glygen.org/publication/PubMed/24385426" } ] }, { "title": "Modulation of ATR-mediated DNA damage checkpoint response by cryptochrome 1.", "journal": "Nucleic Acids Res.", "date": "2014", "authors": "Kang T.H., Leem S.H.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "24489120", "url": "https://glygen.org/publication/PubMed/24489120" } ] }, { "title": "CUL4-DDB1-CDT2 E3 ligase regulates the molecular clock activity by promoting ubiquitination-dependent degradation of the mammalian CRY1.", "journal": "PLoS ONE", "date": "2015", "authors": "Tong X, Zhang D, Guha A, Arthurs B, Cazares V, Gupta N, Yin L", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "26431207", "url": "https://glygen.org/publication/PubMed/26431207" } ] }, { "title": "Distinct roles of HDAC3 in the core circadian negative feedback loop are critical for clock function.", "journal": "Cell Rep.", "date": "2016", "authors": "Shi G, Xie P, Qu Z, Zhang Z, Dong Z, An Y, Xing L, Liu Z, Dong Y, Xu G, Yang L, Liu Y, Xu Y", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "26776516", "url": "https://glygen.org/publication/PubMed/26776516" } ] }, { "title": "USP7 and TDP-43: pleiotropic regulation of cryptochrome protein stability paces the oscillation of the mammalian circadian clock.", "journal": "PLoS ONE", "date": "2016", "authors": "Hirano A, Nakagawa T, Yoshitane H, Oyama M, Kozuka-Hata H, Lanjakornsiripan D, Fukada Y", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "27123980", "url": "https://glygen.org/publication/PubMed/27123980" } ] }, { "title": "CRY1/2 selectively repress PPARdelta and limit exercise capacity.", "journal": "Cell Metab.", "date": "2017", "authors": "Jordan SD, Kriebs A, Vaughan M, Duglan D, Fan W, Henriksson E, Huber AL, Papp SJ, Nguyen M, Afetian M, Downes M, Yu RT, Kralli A, Evans RM, Lamia KA", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "28683290", "url": "https://glygen.org/publication/PubMed/28683290" } ] }, { "title": "Circadian repressors CRY1 and CRY2 broadly interact with nuclear receptors and modulate transcriptional activity.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2017", "authors": "Kriebs A, Jordan SD, Soto E, Henriksson E, Sandate CR, Vaughan ME, Chan AB, Duglan D, Papp SJ, Huber AL, Afetian ME, Yu RT, Zhao X, Downes M, Evans RM, Lamia KA", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "28751364", "url": "https://glygen.org/publication/PubMed/28751364" } ] }, { "title": "DDB1-mediated CRY1 degradation promotes FOXO1-driven gluconeogenesis in liver.", "journal": "Diabetes", "date": "2017", "authors": "Tong X, Zhang D, Charney N, Jin E, VanDommelen K, Stamper K, Gupta N, Saldate J, Yin L", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "28790135", "url": "https://glygen.org/publication/PubMed/28790135" } ] }, { "title": "Differential roles for cryptochromes in the mammalian retinal clock.", "journal": "FASEB J.", "date": "2018", "authors": "Wong JCY, Smyllie NJ, Banks GT, Pothecary CA, Barnard AR, Maywood ES, Jagannath A, Hughes S, van der Horst GTJ, MacLaren RE, Hankins MW, Hastings MH, Nolan PM, Foster RG, Peirson SN", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "29561690", "url": "https://glygen.org/publication/PubMed/29561690" } ] }, { "title": "Autophagy regulates the liver clock and glucose metabolism by degrading CRY1.", "journal": "Cell Metab.", "date": "2018", "authors": "Toledo M, Batista-Gonzalez A, Merheb E, Aoun ML, Tarabra E, Feng D, Sarparanta J, Merlo P, Botre F, Schwartz GJ, Pessin JE, Singh R", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] }, { "title": "JMJD5 links CRY1 function and proteasomal degradation.", "journal": "PLoS Biol.", "date": "2018", "authors": "Saran AR, Kalinowska D, Oh S, Janknecht R, DiTacchio L", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "30500822", "url": "https://glygen.org/publication/PubMed/30500822" } ] }, { "title": "Phosphorylation of CRY1 Serine 71 Alters Voluntary Activity but Not Circadian Rhythms In Vivo.", "journal": "Journal of biological rhythms", "date": "2019", "authors": "Vaughan M, Jordan SD, Duglan D, Chan AB, Afetian M, Lamia KA", "evidence": [ { "database": "iPTMnet", "id": "P97784", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97784" } ], "reference": [ { "type": "PubMed", "id": "31258021", "url": "https://glygen.org/publication/PubMed/31258021" } ] }, { "title": "The duper mutation reveals previously unsuspected functions of Cryptochrome 1 in circadian entrainment and heart disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Sisson C, Bahiru MS, Manoogian ENC, Bittman EL", "evidence": [ { "database": "RefSeq", "id": "NP_031797", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031797" } ], "reference": [ { "type": "PubMed", "id": "35930669", "url": "https://glygen.org/publication/PubMed/35930669" } ] }, { "title": "Vitamin B2-based blue-light photoreceptors in the retinohypothalamic tract as the photoactive pigments for setting the circadian clock in mammals.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Miyamoto Y, Sancar A", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "9600923", "url": "https://glygen.org/publication/PubMed/9600923" } ] }, { "title": "Characterization of photolyase/blue-light receptor homologs in mouse and human cells.", "journal": "Nucleic Acids Res.", "date": "1998", "authors": "Kobayashi K, Kanno S, Smit B, van der Horst GT, Takao M, Yasui A", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "reference": [ { "type": "PubMed", "id": "9801304", "url": "https://glygen.org/publication/PubMed/9801304" } ] } ], "pathway": [ { "id": "mmu:12952", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12952", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q16526-1", "protein_name": "Cryptochrome-1", "gene_name": "CRY1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN", "length": 586 }, "evidence": [ { "id": "45223953", "url": "http://www.informatics.jax.org/homology/45223953", "database": "MGI" }, { "id": "P97784", "url": "https://omabrowser.org/oma/group/P97784/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q32Q86-1", "protein_name": "Cryptochrome-1", "gene_name": "Cry1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYAPGENVPSGGSGGGNCSQGSGILHYAHGDSQQTNPLKQGRSSMGTGLSSGKRPSQEEDAQSVGPKVQRQSSN", "length": 588 }, "evidence": [ { "id": "45223953", "url": "http://www.informatics.jax.org/homology/45223953", "database": "MGI" }, { "id": "P97784", "url": "https://omabrowser.org/oma/group/P97784/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 25, "go_terms": [ { "name": "regulation of DNA damage checkpoint", "id": "GO:2000001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000001", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of glucocorticoid secretion", "id": "GO:2000850", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000850", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of G protein-coupled receptor signaling pathway", "id": "GO:0045744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045744", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "gluconeogenesis", "id": "GO:0006094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006094", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "signal transduction in response to DNA damage", "id": "GO:0042770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042770", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "response to activity", "id": "GO:0014823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014823", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of gluconeogenesis", "id": "GO:0045721", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045721", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "lipid storage", "id": "GO:0019915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019915", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of circadian rhythm", "id": "GO:0042754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042754", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "positive regulation of gluconeogenesis", "id": "GO:0045722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045722", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "response to glucagon", "id": "GO:0033762", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033762", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "entrainment of circadian clock by photoperiod", "id": "GO:0043153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043153", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "negative regulation of glucocorticoid receptor signaling pathway", "id": "GO:2000323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000323", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "regulation of gluconeogenesis", "id": "GO:0006111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006111", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "selective autophagy", "id": "GO:0061912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061912", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "FAD binding", "id": "GO:0071949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071949", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "E-box binding", "id": "GO:0070888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070888", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "nuclear receptor binding", "id": "GO:0016922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016922", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "phosphatase binding", "id": "GO:0019902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019902", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "photoreceptor activity", "id": "GO:0009881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009881", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 279, "end_pos": 281, "annotation": "n_glycosylation_sequon" }, { "start_pos": 549, "end_pos": 551, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation on Ser-247 by MAPK is important for the inhibition of CLOCK-BMAL1-mediated transcriptional activity. Phosphorylation by CSNK1E requires interaction with PER1 or PER2. Phosphorylation at Ser-71 and Ser-280 by AMPK decreases protein stability. Phosphorylation at Ser-588 exhibits a robust circadian rhythm with a peak at CT8, increases protein stability, prevents SCF(FBXL3)-mediated degradation and is antagonized by interaction with PRKDC.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "15298678", "url": "https://glygen.org/publication/PubMed/15298678" }, { "database": "PubMed", "id": "19833968", "url": "https://glygen.org/publication/PubMed/19833968" }, { "database": "PubMed", "id": "11875063", "url": "https://glygen.org/publication/PubMed/11875063" }, { "database": "PubMed", "id": "24158435", "url": "https://glygen.org/publication/PubMed/24158435" } ] }, { "annotation": "Ubiquitinated by the SCF(FBXL3) and SCF(FBXL21) complexes, regulating the balance between degradation and stabilization. The SCF(FBXL3) complex is mainly nuclear and mediates ubiquitination and subsequent degradation of CRY1. In contrast, cytoplasmic SCF(FBXL21) complex-mediated ubiquitination leads to stabilize CRY1 and counteract the activity of the SCF(FBXL3) complex. The SCF(FBXL3) and SCF(FBXL21) complexes probably mediate ubiquitination at different Lys residues. Ubiquitination at Lys-11 and Lys-107 are specifically ubiquitinated by the SCF(FBXL21) complex but not by the SCF(FBXL3) complex. Ubiquitination may be inhibited by PER2. Deubiquitinated by USP7 (PubMed:27123980).", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "23452855", "url": "https://glygen.org/publication/PubMed/23452855" }, { "database": "PubMed", "id": "18953409", "url": "https://glygen.org/publication/PubMed/18953409" }, { "database": "PubMed", "id": "23452856", "url": "https://glygen.org/publication/PubMed/23452856" }, { "database": "PubMed", "id": "17462724", "url": "https://glygen.org/publication/PubMed/17462724" }, { "database": "PubMed", "id": "11889036", "url": "https://glygen.org/publication/PubMed/11889036" }, { "database": "PubMed", "id": "26776516", "url": "https://glygen.org/publication/PubMed/26776516" }, { "database": "PubMed", "id": "27123980", "url": "https://glygen.org/publication/PubMed/27123980" } ] }, { "annotation": "Undergoes autophagy-mediated degradation in the liver in a time-dependent manner. Autophagic degradation of CRY1 (an inhibitor of gluconeogenesis) occurs during periods of reduced feeding allowing induction of gluconeogenesis and maintenance of blood glucose levels.", "evidence": [ { "database": "UniProtKB", "id": "P97784", "url": "https://www.uniprot.org/uniprot/P97784" }, { "database": "PubMed", "id": "29937374", "url": "https://glygen.org/publication/PubMed/29937374" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }