{
    "uniprot_canonical_ac": "P97353-1",
    "uniprot_ac": "P97353",
    "uniprot_id": "SEC1_MOUSE",
    "mass": {
        "chemical_mass": 41464.0,
        "monoisotopic_mass": 41464.0
    },
    "refseq": {
        "ac": "NP_001258507",
        "name": "galactoside 2-alpha-L-fucosyltransferase Sec1",
        "summary": "This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. This gene is predicted to encode a type II membrane protein, which is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. [provided by RefSeq, Dec 2012].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
    },
    "gene_names": [
        {
            "name": "Sec1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P97353",
            "id": "P97353"
        },
        {
            "name": "Fut10; Fut3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507",
            "id": "NP_001258507"
        },
        {
            "name": "Fut3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P97353",
            "id": "P97353"
        },
        {
            "name": "Sec1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507",
            "id": "NP_001258507"
        }
    ],
    "protein_names": [
        {
            "name": "Galactoside 2-alpha-L-fucosyltransferase Sec1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P97353"
        },
        {
            "name": "2.4.1.-",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P97353"
        },
        {
            "name": "Alpha(1,2)FT 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P97353"
        },
        {
            "name": "GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 3; alpha(1,2)FT 3; fucosyltransferase 10; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase FUT-III",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507",
            "id": "NP_001258507"
        },
        {
            "name": "GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P97353"
        },
        {
            "name": "Secretory blood group protein 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P97353"
        },
        {
            "name": "galactoside 2-alpha-L-fucosyltransferase Sec1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507",
            "id": "NP_001258507"
        }
    ],
    "function": [
        {
            "annotation": "Catalyzes the transfer of alpha 1,2-linked fucose to ganglioside GM1 and galacto-N-biose (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P97353",
                    "url": "https://www.uniprot.org/uniprot/P97353#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9TTY3",
                    "url": "https://www.uniprot.org/uniprot/Q9TTY3#function"
                }
            ]
        },
        {
            "annotation": "E-selectin binding activity mediated by the alpha1-3 fucosyltransferases Fut3/Fut6 and Glg1 are instrumental to the formation of bone metastasis. These findings provide unique insights into the functional role of E-selectin as a component of the vascular niche critical for metastatic colonization in bone.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001258507",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
                },
                {
                    "database": "PubMed",
                    "id": "30988423",
                    "url": "https://glygen.org/publication/PubMed/30988423"
                }
            ]
        },
        {
            "annotation": "Expression Analysis and the Roles of the Sec1 Gene in Regulating the Composition of Mouse Gut Microbiota. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001258507",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
                },
                {
                    "database": "PubMed",
                    "id": "36292744",
                    "url": "https://glygen.org/publication/PubMed/36292744"
                }
            ]
        },
        {
            "annotation": "This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. This gene is predicted to encode a type II membrane protein, which is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. [provided by RefSeq, Dec 2012].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001258507",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0050731",
            "recommended_name": {
                "id": "DOID:0050731",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0050731",
                "name": "vitamin B12 deficiency",
                "description": "A vitamin metabolic disorder that results from low blood levels of vitamin B12."
            },
            "synonyms": [
                {
                    "id": "DOID:0050731",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0050731",
                    "name": "cobalamin deficiency",
                    "description": ""
                },
                {
                    "id": "DOID:0050731",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0050731",
                    "name": "hypocobalaminemia",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "0050731",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0050731"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P97353",
                    "url": "https://www.uniprot.org/uniprot/P97353"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Sec1",
            "url": "https://www.uniprot.org/uniprot/P97353",
            "locus": {
                "chromosome": "7",
                "start_pos": 45327110,
                "end_pos": 45343826,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000040364",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000040364"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000040364",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000040364",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "2.4.1.69",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.69&UniProtAcc=P97353",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "GT11",
            "url": "http://www.cazy.org/GT11.html",
            "database": "CAZy",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd11301",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11301",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "56546",
            "url": "https://www.ncbi.nlm.nih.gov/gene/56546",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR002516",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002516",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:56546",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56546",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1928893",
            "url": "http://www.informatics.jax.org/marker/MGI:1928893",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "GHIAYIS",
            "url": "https://omabrowser.org/oma/group/GHIAYIS/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2959824at2759",
            "url": "http://www.orthodb.org/?query=2959824at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11927",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11927",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11927:SF5",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11927:SF5",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01531",
            "url": "http://pfam.xfam.org/family/PF01531",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P97353",
            "url": "http://purl.obolibrary.org/obo/PR_P97353",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "48292",
            "url": "https://www.rhea-db.org/rhea/48292",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "P97353",
            "url": "https://www.uniprot.org/uniprot/P97353",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P97353-1",
            "url": "https://www.uniprot.org/uniprot/P97353-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8CDC9",
            "url": "https://www.uniprot.org/uniprot/Q8CDC9",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8CDC9-1",
            "url": "https://www.uniprot.org/uniprot/Q8CDC9-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPSDSCLLSLTVLQRLRAICPPLSTFYLFFVIFVVSTIFHCHRRLGLVPAPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGHYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGIAADLGQPNTVGSGHASARAPKRHWGALL",
        "length": 368,
        "header": "sp|P97353-1|SEC1_MOUSE Isoform 1 of Galactoside 2-alpha-L-fucosyltransferase Sec1  OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1 CANONICAL=P97353-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P97353-1",
            "url": "",
            "sequence": {
                "sequence": "MPSDSCLLSLTVLQRLRAICPPLSTFYLFFVIFVVSTIFHCHRRLGLVPAPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGHYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGIAADLGQPNTVGSGHASARAPKRHWGALL",
                "length": 368,
                "header": "sp|P97353-1|SEC1_MOUSE Isoform 1 of Galactoside 2-alpha-L-fucosyltransferase Sec1  OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1 CANONICAL=P97353-1"
            },
            "locus": {}
        },
        {
            "isoform_ac": "Q8CDC9-1",
            "url": "",
            "sequence": {
                "sequence": "MPPETAWDRSTVAPSRLEAWWPQTSRPRRIQAVLQRLRAICPPLSTFYLFFVIFVVSTIFHCHRRLSLVPGPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGQYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGIAADLGQPNTVGSGHASARAPKRHWGALL",
                "length": 389,
                "header": "tr|Q8CDC9-1|SEC1_MOUSE Computationally mapped isoform of Galactoside 2-alpha-L-fucosyltransferase Sec1  OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1 CANONICAL=P97353-1"
            },
            "locus": {
                "chromosome": "7",
                "start_pos": 45333700,
                "end_pos": 45327879,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000040636.9",
                        "url": "https://www.ensembl.org/id/ENSMUST00000040636.9"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000045229.7",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000045229.7"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 195,
            "start_aa": "Asn",
            "end_pos": 195,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn195",
            "evidence": [
                {
                    "id": "P97353",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P97353#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 289,
            "start_aa": "Asn",
            "end_pos": 289,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn289",
            "evidence": [
                {
                    "id": "P97353",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P97353#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 315,
            "start_aa": "Asn",
            "end_pos": 315,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn315",
            "evidence": [
                {
                    "id": "P97353",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P97353#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycosyltransferase-activity",
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "GDP-fucose: beta-galactoside alpha1,2-fucosyltransferase, MFUT-II, and not MFUT-I or -III, is induced in a restricted region of the digestive tract of germ-free mice by host-microbe interactions and cycloheximide.",
            "journal": "Biochim. Biophys. Acta",
            "date": "2000",
            "authors": "Lin B, Hayashi Y, Saito M, Sakakibara Y, Yanagisawa M, Iwamori M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P97353",
                    "url": "https://www.uniprot.org/uniprot/P97353"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11018479",
                    "url": "https://glygen.org/publication/PubMed/11018479"
                }
            ]
        },
        {
            "title": "Molecular cloning, genomic mapping, and expression of two secretor blood group alpha (1,2)fucosyltransferase genes differentially regulated in mouse uterine epithelium and gastrointestinal tract.",
            "journal": "J. Biol. Chem.",
            "date": "2001",
            "authors": "Domino SE, Zhang L, Lowe JB",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P97353",
                    "url": "https://www.uniprot.org/uniprot/P97353"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11323419",
                    "url": "https://glygen.org/publication/PubMed/11323419"
                }
            ]
        },
        {
            "title": "Bone vascular niche E-selectin induces mesenchymal-epithelial transition and Wnt activation in cancer cells to promote bone metastasis.",
            "journal": "Nature cell biology",
            "date": "2019",
            "authors": "Esposito M, Mondal N, Greco TM, Wei Y, Spadazzi C, Lin SC, Zheng H, Cheung C, Magnani JL, Lin SH, Cristea IM, Sackstein R, Kang Y",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001258507",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30988423",
                    "url": "https://glygen.org/publication/PubMed/30988423"
                }
            ]
        },
        {
            "title": "Expression Analysis and the Roles of the Sec1 Gene in Regulating the Composition of Mouse Gut Microbiota.",
            "journal": "Genes",
            "date": "2022-10-14",
            "authors": "Ren Zhanshi, Fan Hairui, Gu Shanshen, Liu Haoyu, Wu Zhengchang, Wang Haifei, Bao Wenbin, Wu Shenglong",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001258507",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258507"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36292744",
                    "url": "https://glygen.org/publication/PubMed/36292744"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:56546",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56546",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "F1MAG9-1",
            "protein_name": "L-Fucosyltransferase",
            "gene_name": "Sec1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MPPETAWDRSTVAPSRLAAWWSRTNWPRRIQAALQGLKAICPPLSTFYLFFVIFVLSTIFHCHRRLSLVPAPWASSALVVLSPRHLPREGMFTINVRGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTARRIPWQKYHLNDWMEERYRHIPGHYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLRVNGSQPSTFVGVHVRRGDYVHVMPKVWKGVVADRGYLEKALDMFRARYSSPVFVVTSDDMSWCRKSIVASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPSSPFHKVFKPEAAYLPEWVGIAADLEQPNRGAPGHASARAPKSHQRTLL",
                "length": 389
            },
            "evidence": [
                {
                    "id": "45241321",
                    "url": "http://www.informatics.jax.org/homology/45241321",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q10981-1",
            "protein_name": "Galactoside alpha-(1,2)-fucosyltransferase 2",
            "gene_name": "FUT2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH",
                "length": 343
            },
            "evidence": [
                {
                    "id": "45241321",
                    "url": "http://www.informatics.jax.org/homology/45241321",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 10,
                "go_terms": [
                    {
                        "name": "protein glycosylation",
                        "id": "GO:0006486",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lipid metabolic process",
                        "id": "GO:0006629",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "carbohydrate metabolic process",
                        "id": "GO:0005975",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of sprouting angiogenesis",
                        "id": "GO:1903672",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903672",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "fucosylation",
                        "id": "GO:0036065",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036065",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of endothelial cell migration",
                        "id": "GO:0010595",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "oligosaccharide biosynthetic process",
                        "id": "GO:0009312",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009312",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell-matrix adhesion",
                        "id": "GO:0001954",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001954",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory bulb development",
                        "id": "GO:0021772",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021772",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of endothelial cell-matrix adhesion via fibronectin",
                        "id": "GO:1904906",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904906",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "Golgi cisterna membrane",
                        "id": "GO:0032580",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "galactoside 2-alpha-L-fucosyltransferase activity",
                        "id": "GO:0008107",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008107",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "fucosyltransferase activity",
                        "id": "GO:0008417",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008417",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P97353",
                                "url": "https://www.uniprot.org/uniprot/P97353"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 195,
            "end_pos": 197,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 289,
            "end_pos": 291,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 315,
            "end_pos": 317,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "48292",
            "name": "",
            "equation": "ganglioside GM1 + GDP-beta-L-fucose = ganglioside Fuc-GM1 + GDP + H(+)",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q10980-1",
                "Q10984-1",
                "F1MAG9-1",
                "P19526-1",
                "Q10981-1",
                "P97353-1",
                "Q9JL27-1",
                "O09160-1"
            ],
            "evidence": [
                {
                    "id": "48292",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/48292"
                }
            ]
        }
    ],
    "reaction_participants": [],
    "reaction_enzymes": [
        {
            "uniprot_ac": "F1MAG9",
            "gene_name": "Sec1",
            "activity": [
                {
                    "ec_number": "2.4.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1MAG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09160",
            "gene_name": "Fut1",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "O09160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09160"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "O09160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09160"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09160"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P19526",
            "gene_name": "FUT1",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "P19526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19526"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "P19526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97353",
            "gene_name": "Sec1",
            "activity": [
                {
                    "ec_number": "2.4.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97353"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q10980",
            "gene_name": "Fut1",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10980"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10980"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q10981",
            "gene_name": "FUT2",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10981"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10981"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q10984",
            "gene_name": "Fut2",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10984",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10984"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q10984",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10984"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q10984",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q10984"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JL27",
            "gene_name": "Fut2",
            "activity": [
                {
                    "ec_number": "2.4.1.344",
                    "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q9JL27",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JL27"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.69",
                    "activity": "a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E)) + GDP-beta-L-fucose = alpha-L-fucosyl-(1->2)- beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + GDP + H(+).",
                    "evidence": [
                        {
                            "id": "Q9JL27",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JL27"
                        }
                    ]
                },
                {
                    "ec_number": "2.4.1.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JL27",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JL27"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [
        {
            "glytoucan_ac": "G00027JG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00069YC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00094SE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00164QP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00376RB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00394CR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00428HK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00480NH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G00496OX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00531ZU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G00666EC",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G00707RC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00729SA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00754TS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00789VI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00797ZX",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G00803TF",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G00901NZ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G00907IC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G00924FH",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G00952LS",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G01243KR",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G01378OV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G01453BU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G01476WA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G01489UZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G01532FF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G01577DB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G01625GQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G01744JD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G01747FB",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G01784XC",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G01923FT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G01996OW",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G02020YO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G02032MW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G02078ZZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G02150AC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G02188RD",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G02230VA",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G02393LQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G02442MH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G02563ZC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G02608NW",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G02642GO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G02729OV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G02799CL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G02990AF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03035VB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03140AX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03304QB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03339IQ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G03347EL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G03404VQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G03549GG",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G03605AU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03644PT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G03770XP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G03792OA",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G03796EF",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G03825XC",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G03847RK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G03877AD",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G03916DL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G04002YJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G04014FP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G04074KJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04091CN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04185QP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04241HQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G04298QC",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G04421LE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04428BJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04459VF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04467BX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G04478DK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04513DL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G04536JV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04548YV",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G04653HU",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G04751OE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G04842IW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04949CY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G04970RV",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G04984PI",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G05081RC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G05183GM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G05187DJ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G05227QG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G05278GV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G05378UG",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G05400IQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G05402FG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G05767GS",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G05784LD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G05801RW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G05994BK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G06032HI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G06036CF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G06152YZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G06283RQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G06341YK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G06408QU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G06437BU",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G06507BB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G06582LH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G06648CG",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G06650FN",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G06710OE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G06968OS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G06971NQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G07041CT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G07061YF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07141OG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07145VL",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G07164WO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G07262RR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G07435LO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07443RM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07578MJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07692KY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07695IB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07764JS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07869UA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G07904XW",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G07913PZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G08016YO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08046LM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08055MG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08113XU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G08190JB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G08205LJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G08242BT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G08244YE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08267YC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G08308ZP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08382XT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G08474XG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G08709JB",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G08784DO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09019KT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G09079WY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09125WG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G09139MX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09153LX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09154YX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09226UP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09287HW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09424UT",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G09441VY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09453OL",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G09520ZQ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G09538AR",
            "type": "N-linked",
            "subtype": "Arm-fucosylated"
        },
        {
            "glytoucan_ac": "G09698FP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G09727XA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G09781FH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09831CM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G09921KZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G09941BM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10388YZ",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G10453CW",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G10480CH",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G10487BH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10514PF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10581YA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10608NX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10627KR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G10687EF",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G10706IL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G10924UK",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G10954DW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11061VC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G11105TT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11201QY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11253PI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11256DQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G11272SN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11287YT",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G11288UE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G11366PY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G11699WH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G11876US",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G12111NA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12174RN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G12203WB",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G12230UX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12232OT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12350CH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12389NM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G12396GB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12526XX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12573LN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G12573WR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13104VJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13122AV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G13168IS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13205MF",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G13292XY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13441KG",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G13634RR",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G13672YG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G13695SV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13767YY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G13863XN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13894RO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G13976VB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14009XM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14095XN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G14125ZW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14296RM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G14303LL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14317JF",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G14354BD",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G14375KO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14380OJ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G14453LC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14488UY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G14555ST",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G14617QG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G14623FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14646AF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14761OA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G14812IG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G14815WH",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G14868UU",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G14965PJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G14978ZY",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G15003XX",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G15099DI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G15249CA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G15307GJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G15446MA",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G15484AW",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G15605OU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G15626ED",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G15631KB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G15860LG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G15876HU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G16078YI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G16327YW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G16440EL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G16441MS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G16546ZZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G16739XD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G16768QV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17050CK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17269LY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G17280PS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17286ZM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G17331WA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17454VN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17480GI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G17673XH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17733ZN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G17827ZK",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G17843GH",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G18117YG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18197AJ",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G18219CJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G18299YA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18423OV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G18472TI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G18653BM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18695QD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18707MU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G18814OJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G18837VD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G18853HA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18855WX",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G18878GS",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G18878PL",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G18932FF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18950NM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G18953GB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G19026NP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G19135OS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G19146BQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G19238ZQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G19287UY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G19555CW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G19615BB",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G19722GZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G19778AE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G19807JC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20018DL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G20038KA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20061RO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G20064ZN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20222KH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20310DM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20438JB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G20440GC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20551LK",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G20566UO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20713UI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G20735IM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20752RM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20828MB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20835CN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G20854YP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G20988ZU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G20993TP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G21021HG",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G21029LJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G21050RT",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G21100JS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G21297DP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G21385AQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G21564HN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G21586NB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G21672LC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G21755QG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G21807KQ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G21845NG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G21939WK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22012EW",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G22107KA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G22117HL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G22327AZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22385OT",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G22498IQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22511JU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G22626SX",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G22629JM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G22731HP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G22733YM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G22793FR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22815DC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22841DM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G22849VW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23021IW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23021NE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G23066SI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23119MJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23134ZR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23193CN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23250OE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G23262BU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23340ZN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23419AQ",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G23458QH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23463KX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23491CM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G23494UZ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G23560WQ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G23824AT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23866BG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23870PO",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G23888EZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23893ZL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G23901NY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G23909XW",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G23975EE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24146VR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G24151NT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24186OV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G24256XU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24296ZA",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G24346JZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G24366RG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24767EG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G24790YU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24856YP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G24970IL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G25044JE",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G25065CJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25233TU",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G25382RS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25436EB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G25439DD",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G25443TD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25538MM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25612EW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25705WX",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G25764DO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G25845BH",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G25937FN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26185YJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26228QQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26394UA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G26429CZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26472EX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26497EU",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G26827ST",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G26877LE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G26949BV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G27040MJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G27366LV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G27409LG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G27520PV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G27526RV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G27546OZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G27641PQ",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G27655DO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G27814XA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G27893KR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G27994UV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G28040SC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28077AI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28085OS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28116PK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28136FA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28226YW",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G28329XZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G28337WM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G28505XN",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G28570DO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G28599FB",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G28723UT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G28750LN",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G28782ND",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G28878FC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G29025YS",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G29144HY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G29524AT",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G29628MO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G29667VM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G29733CJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G29739GM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G29754CL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G29879FQ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G29931YE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G30085SO",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G30086CM",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G30241UB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G30434QC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G30627OI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G30651QG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G30933VG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31040SL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G31087MR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31101EW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31118TG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31198XA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G31252KI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G31372TK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31457ZU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31494OZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G31540HC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31587OK",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G31686QZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G31849TV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G31898CI",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G31982GY",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G31997DH",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G32026LV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32112SX",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G32216CL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G32253LY",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G32333NU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32378BV",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G32417DU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G32426JY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32541GR",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G32588AA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32735YJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32747GU",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G32785BQ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G32863IR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G32944VN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G33018IJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33159AG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33202XC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G33262YZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G33294DV",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G33345BX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33401IN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33418YX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33479HZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33569OU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33669VL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G33740YL",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G33748AU",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G33860PM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33877TL",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G33886DT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33899KJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33908QE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33961NR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G33963JX",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G33981FE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G34096TA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G34126VO",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G34143CH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G34168KI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G34449IE",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G34962LY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35106OM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G35127VU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35234CM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35301YI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35343OD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35409SK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35432EX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35482NV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G35486FC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35642GA",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G35718GY",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G35747ZX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G35750SU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35778AN",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G35875IX",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G35880DP",
            "type": "N-linked",
            "subtype": "Arm-fucosylated"
        },
        {
            "glytoucan_ac": "G35884UD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G35898DT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35910XN",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G35932XK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G35941VN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35946GZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G35947YD",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G35949CT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36036BI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G36046VV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36047BO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36138ZV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36157LL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G36287XJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G36404TW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G36406GU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36460YS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36479RD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36482YM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36581MF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G36597IG",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G36651MN",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G36774NW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36786TD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G36835IG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G36983SB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37115PC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37134CP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37239FO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37282LW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37325HA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37354FL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37381UQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37597VQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37601UJ",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G37638KH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37745NY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G37772CO",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G37779JP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G37825LG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G37827FY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G37841WI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G37868JH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G38002BK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38027UF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38075PP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G38120GJ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G38121JC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G38189CI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G38207GT",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G38234JH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38241TC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G38351JR",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G38361SH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38462TG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38468XG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38506CT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38688TT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38748VM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G38812YS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G38859XU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G38933BS",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G39136MQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39162CC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39246KD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39260NC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39283IB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39308RS",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G39321UZ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G39326PP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G39340CD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G39444QC",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G39509DP",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G39516UK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39523KI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39643KO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G39676NA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39720OK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G39948NU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40173TB",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G40181EN",
            "type": "N-linked",
            "subtype": "Alditol-reduced"
        },
        {
            "glytoucan_ac": "G40270LS",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G40294ED",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40319SF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40347YM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40393FZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40397HC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40539YV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40569DS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G40606LI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G40689UV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G40737YL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41227XH",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G41330YY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41331JX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G41358UX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41384PQ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G41444DX",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G41498BE",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G41539MU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41545LH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41552DE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41552FO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41658RK",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G41896LD",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G41919TD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G41928NU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42120JR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G42154JB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G42239OO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42245KI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42325VD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42368XT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42407QV",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G42603RO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42619IV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G42668PC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42752PT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42828SU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42829WM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G42883ON",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G42908EG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G43001RF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43059PA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43167FQ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G43204BV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43265YA",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G43572AH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43629KF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43639BV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43656YN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43662XM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43744JB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43925AD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43933MN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43946PN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G43972TU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G43993DD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G44182FH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G44339HI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G44342ZF",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G44463UK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G44466VN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G44510KF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G44543KU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G44572NU",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G44623TX",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G45000ZN",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G45235OK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G45304XA",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G45402WV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G45516VR",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G45565NV",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G45660WC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G45699QA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G45819SH",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G45861YI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G45917UD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G46021KV",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G46029TT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G46168RR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G46500XL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G46503KK",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G46609ZR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G46763GM",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G46868TY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G46935AJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G46960TX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47152AG",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G47171PS",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G47174QJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47175EF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G47180UC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G47307MO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47391NN",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G47531XE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G47537XW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47590GJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47606XQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G47652ZE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47669CK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G47709SA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47772RH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G47847UW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G47952MI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G47975LL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48089QY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48115DD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48256FI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48321FJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48355MU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48440GN",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G48499NG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G48809VN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G49104WF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G49130JL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G49221CG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G49228QV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G49277CJ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G49280JI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G49302PT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G49394FL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G49401WK",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G49508KM",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G49542DJ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G49603LL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G49668VU",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G49936GP",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G50003EV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G50198YU",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G50223FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G50362JF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G50613GW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G50619VO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G50805QB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G50809LR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51018LC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51080VE",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G51091HB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G51114IJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51140AE",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G51340HW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G51347IO",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G51349BU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51502JK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G51557QE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51809TM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G51862BI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G51896IF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G51947OY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G52080WL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G52112MC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G52262VT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G52318OF",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G52376IF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G52471BY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G52515QC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G52608IK",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G52839BU",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G52886RR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G52953EP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G52956BX",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G53016WG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53034PL",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G53084MW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53225BR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53246IE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53303ZX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53330OZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53342MA",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G53404LB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53440PM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G53498KG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53542OI",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G53809VI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G53878DC",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G53880XP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G53996MC",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G54043EU",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G54151YB",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G54212AC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G54263QD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G54334WY",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G54335XN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G54394ER",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G54434IR",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G54439SD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G54542VV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G54561II",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G54651DQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G54795GY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55025YG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G55169KX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G55174HS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55184GH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G55327VV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G55396DW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G55529NV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55567ZW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55753QM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G55880FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55967EP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G55986UN",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G56067ON",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G56186MJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G56202KK",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G56293JI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G56339QG",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G56427WT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G56529CD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G56621NM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G56678WD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G56734EJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G56979BY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G57068ZS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G57247BR",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G57296XM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G57471CR",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G57504TA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G57545VN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G57568CV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G57592QM",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G57675TR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G57740WC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G57772TI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G57976DO",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G58106KY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G58145JY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58195CE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58201OX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58219MI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G58244GN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G58276QF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58362DI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G58414HI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58537BJ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G58577QT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58582XO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58620PN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58683GH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G58783PZ",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G58815WR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G58827HR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G58959YB",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G58980RJ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G59155GF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59332RZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59379KN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59498PG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59595AB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G59658KK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59659CN",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G59679CG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G59742ZT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G59910CM",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G59930AW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59944EN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G59951KW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G59999BN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G60067UC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G60138JZ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G60215UL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60282OI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G60341PX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G60457MA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G60485RX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60564DP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60610NA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60660BN",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G60687DB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G60705KN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60731ZH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G60833BB",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G60883HN",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G60941RE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G60977LC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G61011QL",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G61072JZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G61159LY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G61244WO",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G61311ZY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G61339UO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G61411XJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G61501FW",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G61539GW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G61747RH",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G61780GR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G61956VN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62001NV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62014YU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62015ZM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G62044ND",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62081IR",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G62165LJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G62307SM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62311FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62339AO",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62407IF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G62471ZA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62519IY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62527ZD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G62574YR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G62720NT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62741IO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G62779OI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G62820PI",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G62824TL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G62945MQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G63193BW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G63193FF",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G63231BS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G63404EE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G63474NY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G63644AZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G63660JP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G63734KU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G63932ZM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G63946SF",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G64127GJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G64165TJ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G64305XQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G64468KS",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G64610UD",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G64774WV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G64850DY",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G64904FE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G64904QS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G64996BH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65037OI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65200OC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65249DN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65321RW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65348IZ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G65364FS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65369IB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65600KO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65669BM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65837AE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G65955VU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66030KY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66040YD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66166BF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66184ZO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G66205CG",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G66265KN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G66271TT",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G66301VC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66359LV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G66360FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66367EU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G66408GD",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G66421OE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66512FS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66572SF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G66689PB",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G66699QG",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G66741QE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G66904GT",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G66977DX",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G67407NJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67650WH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67686RZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67775HG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67796SA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67821CP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67878YZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G67883AD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68062BK",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G68133RV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68175FX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68200GL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G68253RD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G68384KC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68458SS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68529LC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68817WF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G68894XH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G68950LW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G69018AJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G69022KK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69137GO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69229KW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G69233PF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G69261IG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69327YC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69445ZX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69446XZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69479TC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G69685RI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69748TK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69788BR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G69831AM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G69876CC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G70163ZD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G70387YT",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G70617CF",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G70623QI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G70631UV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G70919RK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G70945OS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G71091AL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71094KR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71306LD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71333BH",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G71479KG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71487ZS",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G71707QJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71773FH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71816WC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G71832QJ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G71835BN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G71964JP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71969OB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G71999UY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G72070EH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G72263DG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G72279PA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G72462NP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G72526DQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G72830DK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73033IA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73162HV",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G73330CF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G73351YM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73440TD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73522II",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G73582RP",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G73653TX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73829NH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G73991ZU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G74012OU",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G74130TT",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G74225AH",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G74242PX",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G74286WC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G74324QB",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G74489AS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G74493GE",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G74632FV",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G74782FR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G74917JV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G74945NC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G74975UG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75042KU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75100GD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G75171WW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75192PM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G75197HN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G75381CL",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G75389LS",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75500ME",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G75547HK",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G75549SI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75599HG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75637RB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75704MB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G75749JP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G75906TR",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G76127VR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G76213KN",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G76214JA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76299ZG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76317AM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G76362LL",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G76389HC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76431SN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G76481US",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G76505ZE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76561LL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76603DR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G76726PJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76763LN",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G76789KR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G76863NB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76876LB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G76986FH",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G76997PL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G77136XW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77208XM",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G77213YG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77218JF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G77413CE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G77521TX",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G77550KK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77627UV",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G77674IK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77740PR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77937PE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G77960OV",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G78011OA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G78032US",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G78126EU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G78205VT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G78262KC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G78293EI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G78734OE",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G78757VY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G78792AJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G78992FU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79011EQ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79018NX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G79019WG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79077OL",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G79183WP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G79222ND",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79224KH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79254LX",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G79394LC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G79600DE",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G79617NL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G79762CW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G79781PS",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G79790LK",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G79915IB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G79968EZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G80099PR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G80346ZU",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G80403NF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G80510YA",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G80567MC",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G80583XN",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G80618TG",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G80667HT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G80719YH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G80848DN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G81013HU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G81085EP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G81201TR",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G81214EK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G81221QB",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G81389EF",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G81439BR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G81471KU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G81534KB",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G81617NU",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G81628EZ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G81632WR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G81725CS",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G81825YE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G81832CY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G81832XS",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G81896KF",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G82054AK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82092PV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82140BL",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G82227EQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G82285OB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G82334OE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82362HL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82363EY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82412EH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82693QG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G82728DG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G82906DM",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G82955EQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G82970CD",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G83103PA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G83134ZR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G83206CA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G83241PZ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G83492DO",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G83502DX",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G83514WC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G83619SL",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G83864PP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G83952ID",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G84122DM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G84332AC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G84365LE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G84560PS",
            "type": "N-linked",
            "subtype": "Tetraantennary"
        },
        {
            "glytoucan_ac": "G84596RP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G84646MS",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G84647SC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G84783XD",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G84853WN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G84901UD",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G84942UA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G85039TI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G85284LO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G85284MK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G85392NL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G85393KI",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G85463RK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G85652RK",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G85657EG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G85721WE",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G85997RC",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G86002IU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86002PC",
            "type": "N-linked",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G86085HN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86117ZB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G86202BL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G86239DV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86294AN",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G86298IX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G86407VN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86414FL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G86555OF",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G86571PO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86669AN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86681SC",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G86736BF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G86737YW",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G86928SV",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G86997OW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87018HM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87073UP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87107PF",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87218FV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G87244OY",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G87249CK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G87256FP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G87349YT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87418QZ",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G87444MS",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G87470NI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87528ZH",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G87535DG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G87574LM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G87888LG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G88014YP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G88050IP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G88313DY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G88426SE",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G88500KL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G88505QR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G88687UE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G88759BF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G88828CK",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G88837PJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G88975RE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G89026DU",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G89058HG",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G89058LG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G89058RF",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G89091LQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G89137AE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G89255EP",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G89270VP",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G89333YV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G89362MU",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G89398MH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G89603EU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G89611JH",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G89615SV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G89748NG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G89946SW",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G89990JE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90135ZJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90193GR",
            "type": "N-linked",
            "subtype": "Hybrid"
        },
        {
            "glytoucan_ac": "G90205AB",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G90221FQ",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G90251SV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90423CD",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G90451QF",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G90572ER",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G90575VK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90689AW",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G90724OH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90739UE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90746ZG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90767ZX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90771OP",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G90818DN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90829NZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90926WR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G90965BZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G90999PU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91093AL",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G91103IY",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G91143IL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G91151XY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G91181WA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91191RB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91227UA",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G91368WO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91386RN",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G91459EI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91470EV",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G91474LB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91487MA",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G91659ZV",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G91669BT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91684MM",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G91731DX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91732VA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G91756JQ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G91775YA",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G92215RW",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G92302BV",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G92332SI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G92399AI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G92485YK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G92501LD",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G92509CI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G92627GM",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G92695JQ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G93000QZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93045SX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93088DU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93090IR",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G93160RG",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G93176JI",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G93266DC",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G93333OF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93427DE",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G93447XI",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G93450CE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93526OI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G93597FN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93636BY",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G93791KT",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G93801LA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93828IC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93861XR",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93909NH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G93984MO",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94058TU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94062FP",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94146NJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94232LU",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G94435QH",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G94437IW",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G94502LK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94514IB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94516KE",
            "type": "N-linked",
            "subtype": "Core-fucosylated"
        },
        {
            "glytoucan_ac": "G94595ZZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94599QJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94618YC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G94621HP",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G94627QP",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G94705OR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G94736EY",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G94768NG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94804ZC",
            "type": "N-linked",
            "subtype": "Triantennary"
        },
        {
            "glytoucan_ac": "G94808XV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G94814YD",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G94816EL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G94824OK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G95006CL",
            "type": "Other",
            "subtype": "Other"
        },
        {
            "glytoucan_ac": "G95019KZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G95144UL",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G95292IF",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G95430GC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G95448VV",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G95512GZ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G95593KU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G95788IL",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G95890CG",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G95981KO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G96057TO",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G96066HD",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96067FK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G96349RY",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G96373OE",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96463EY",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96540EH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96576RP",
            "type": "O-linked",
            "subtype": "Core 6"
        },
        {
            "glytoucan_ac": "G96599KT",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96622FI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96663HG",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96715CG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G96763TB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G96820VB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G96971EN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G97452SL",
            "type": "O-linked",
            "subtype": "Core 3"
        },
        {
            "glytoucan_ac": "G97553OZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G97644GG",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G97765TT",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G97777ZK",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G97840DJ",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G98008PC",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G98073MH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98074JA",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98217YG",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G98270SB",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G98419CX",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G98437LC",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G98473NJ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98518WL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98540XI",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98654DA",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G98689EK",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G98698LI",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G98873GM",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98891IZ",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G98940EW",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G98950NS",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G98977CH",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99039KB",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99236CU",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99281CN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99307NJ",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G99309EE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G99315PE",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G99372JL",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99454KR",
            "type": "O-linked",
            "subtype": "Core 1"
        },
        {
            "glytoucan_ac": "G99465IE",
            "type": "N-linked",
            "subtype": "Complex"
        },
        {
            "glytoucan_ac": "G99567UC",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99772FN",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99783GX",
            "type": "O-linked",
            "subtype": "Core 2"
        },
        {
            "glytoucan_ac": "G99792ZO",
            "type": "O-linked",
            "subtype": "Core 4"
        },
        {
            "glytoucan_ac": "G99893CA",
            "type": "O-linked",
            "subtype": "Core 6"
        }
    ],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}