{ "uniprot_canonical_ac": "P83869-1", "uniprot_ac": "P83869", "uniprot_id": "DSO2_DROME", "mass": { "chemical_mass": 4995.0, "monoisotopic_mass": 4995.0 }, "refseq": { "ac": "NP_001033962", "name": "Daisho2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962" }, "gene_names": [ { "name": "Dso2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P83869", "id": "P83869" }, { "name": "CG33990; DIM 14; Dmel\\CG33990; dso2; im14; IM14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962", "id": "NP_001033962" }, { "name": "CG33990", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P83869", "id": "P83869" }, { "name": "Dso2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962", "id": "NP_001033962" }, { "name": "IM14", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P83869", "id": "P83869" } ], "protein_names": [ { "name": "Daisho2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P83869" }, { "name": "CG33990-PA; Dso2-PA; immune induced molecule 14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962", "id": "NP_001033962" }, { "name": "DIM-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P83869" }, { "name": "DIM4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P83869" }, { "name": "Daisho2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962", "id": "NP_001033962" }, { "name": "Immune-induced peptide 14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P83869" } ], "function": [ { "annotation": "Peptide which plays a role in the humoral immune response to a subset of filamentous fungi, including F.oxysporum and F.verticillioides.", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869#function" }, { "database": "PubMed", "id": "32038657", "url": "https://glygen.org/publication/PubMed/32038657" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Dso2", "url": "https://www.uniprot.org/uniprot/P83869", "locus": { "chromosome": "2R", "start_pos": 20870678, "end_pos": 20870392, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0067905", "url": "https://www.ensembl.org/id/FBgn0067905" } ] } } ], "crossref": [ { "id": "FBgn0067905", "url": "https://bgee.org/?page=gene&gene_id=FBgn0067905", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0067905", "url": "https://flybase.org/reports/FBgn0067905", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "3885603", "url": "https://www.ncbi.nlm.nih.gov/gene/3885603", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "dme:Dmel_CG33990", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG33990", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PR_P83869", "url": "http://purl.obolibrary.org/obo/PR_P83869", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001033962", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001033962", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P83869-1", "url": "https://www.uniprot.org/uniprot/P83869-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN", "length": 46, "header": "sp|P83869-1|DSO2_DROME Isoform 1 of Daisho2 OS=Drosophila melanogaster OX=7227 GN=Dso2 PE=1 SV=2 CANONICAL=P83869-1" }, "isoforms": [ { "isoform_ac": "P83869-1", "url": "", "sequence": { "sequence": "MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN", "length": 46, "header": "sp|P83869-1|DSO2_DROME Isoform 1 of Daisho2 OS=Drosophila melanogaster OX=7227 GN=Dso2 PE=1 SV=2 CANONICAL=P83869-1" }, "locus": { "chromosome": "2R", "start_pos": 20870626, "end_pos": 20870425, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0100038", "url": "https://www.ensembl.org/id/FBtr0100038" }, { "database": "Ensembl Peptide", "id": "FBpp0099553", "url": "https://www.ensembl.org/id/FBpp0099553" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Proteomic analysis of the systemic immune response of Drosophila.", "journal": "Mol. Cell. Proteomics", "date": "2004", "authors": "Levy F., Bulet P., Ehret-Sabatier L.", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "reference": [ { "type": "PubMed", "id": "14645501", "url": "https://glygen.org/publication/PubMed/14645501" } ] }, { "title": "The Daisho Peptides Mediate Drosophila Defense Against a Subset of Filamentous Fungi.", "journal": "Front. Immunol.", "date": "2020", "authors": "Xu Y., Wasserman S.A., Cohen L.B., Lin S.J.H., Lindsay S.A.", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "reference": [ { "type": "PubMed", "id": "32038657", "url": "https://glygen.org/publication/PubMed/32038657" } ] }, { "title": "Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Uttenweiler-Joseph S, Moniatte M, Lagueux M, Van Dorsselaer A, Hoffmann JA, Bulet P", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "reference": [ { "type": "PubMed", "id": "9736738", "url": "https://glygen.org/publication/PubMed/9736738" } ] } ], "pathway": [ { "id": "dme:Dmel_CG33990", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG33990", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "defense response", "id": "GO:0006952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006952", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" }, { "name": "antifungal humoral response", "id": "GO:0019732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019732", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" }, { "name": "response to bacterium", "id": "GO:0009617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009617", "evidence": [ { "database": "UniProtKB", "id": "P83869", "url": "https://www.uniprot.org/uniprot/P83869" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }