{ "uniprot_canonical_ac": "P83118-1", "uniprot_ac": "P83118", "uniprot_id": "MTH11_DROME", "mass": { "chemical_mass": 62092.0, "monoisotopic_mass": 62092.0 }, "refseq": { "ac": "NP_001262465", "name": "methuselah-like 11, isoform D", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465" }, "gene_names": [ { "name": "mthl11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P83118", "id": "P83118" }, { "name": "CG31147; Dmel\\CG31147; Mthl11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465", "id": "NP_001262465" }, { "name": "CG31147", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P83118", "id": "P83118" }, { "name": "Mth-like-11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P83118", "id": "P83118" }, { "name": "mthl11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465", "id": "NP_001262465" } ], "protein_names": [ { "name": "Probable G-protein coupled receptor Mth-like 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P83118" }, { "name": "CG31147-PD; mthl11-PD; Mth-like 11; Mth-like-11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465", "id": "NP_001262465" }, { "name": "Protein methuselah-like 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P83118" }, { "name": "methuselah-like 11, isoform D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465", "id": "NP_001262465" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "mthl11", "url": "https://www.uniprot.org/uniprot/P83118", "locus": { "chromosome": "3R", "start_pos": 10402966, "end_pos": 10401032, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0045443", "url": "https://www.ensembl.org/id/FBgn0045443" } ] } } ], "crossref": [ { "id": "FBgn0045443", "url": "https://bgee.org/?page=gene&gene_id=FBgn0045443", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00251", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00251", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd15039", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15039", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0045443", "url": "https://flybase.org/reports/FBgn0045443", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "117467", "url": "https://www.ncbi.nlm.nih.gov/gene/117467", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR010596", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010596", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017981", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017981", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023311", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023311", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036272", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036272", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG31147", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG31147", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WSAMYYF", "url": "https://omabrowser.org/oma/group/WSAMYYF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3108840at2759", "url": "http://www.orthodb.org/?query=3108840at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47154", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47154", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47154:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47154:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06652", "url": "http://pfam.xfam.org/family/PF06652", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P83118", "url": "http://purl.obolibrary.org/obo/PR_P83118", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001262465", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262465", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P83118-1", "url": "https://www.uniprot.org/uniprot/P83118-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P83118-2", "url": "https://www.uniprot.org/uniprot/P83118-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGMFRVEYLLLGILVIGVRSRDIPNCDFFDTVQLRESEKLCNGSYRYEDVVIPAKLTGKYDYEIDYDGDRVSVPKHIRGCVCKLKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYLSKQEFCLQPNPTSTGKNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCNHEMFRLIRKRIQNRNITSLELTNTSRPVESEKMADVELGK", "length": 532, "header": "sp|P83118-1|MTH11_DROME Isoform 1 of Probable G-protein coupled receptor Mth-like 11 OS=Drosophila melanogaster OX=7227 GN=mthl11 PE=3 SV=3 CANONICAL=P83118-1" }, "isoforms": [ { "isoform_ac": "P83118-1", "url": "", "sequence": { "sequence": "MGMFRVEYLLLGILVIGVRSRDIPNCDFFDTVQLRESEKLCNGSYRYEDVVIPAKLTGKYDYEIDYDGDRVSVPKHIRGCVCKLKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYLSKQEFCLQPNPTSTGKNYSLIVAFNCIQKPSMKMAYGRFECVRKSRLSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCNHEMFRLIRKRIQNRNITSLELTNTSRPVESEKMADVELGK", "length": 532, "header": "sp|P83118-1|MTH11_DROME Isoform 1 of Probable G-protein coupled receptor Mth-like 11 OS=Drosophila melanogaster OX=7227 GN=mthl11 PE=3 SV=3 CANONICAL=P83118-1" }, "locus": { "chromosome": "3R", "start_pos": 10402951, "end_pos": 10401051, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0332552", "url": "https://www.ensembl.org/id/FBtr0332552" }, { "database": "Ensembl Peptide", "id": "FBpp0304810", "url": "https://www.ensembl.org/id/FBpp0304810" } ] } }, { "isoform_ac": "P83118-2", "url": "", "sequence": { "sequence": "MGMFRVEYLLLGILVIGVRSRDIPNCDFFDTVQLRESEKLCNGSYRYEDVVIPAKLTGKYDYEIDYDGDRVSVPKHIRGCVCKLKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYLSKQEFCLQPNPTSTGKNYSLIVAFNCIQKPSMKMAYVKFSSVFFMVITIAAYLWLPKFRSLHGKCCNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCNHEMFRLIRKRIQNRNITSLELTNTSRPVESEKMADVELGK", "length": 515, "header": "sp|P83118-2|MTH11_DROME Isoform 2 of Probable G-protein coupled receptor Mth-like 11 OS=Drosophila melanogaster OX=7227 GN=mthl11 PE=3 SV=3 CANONICAL=P83118-1" }, "locus": { "chromosome": "3R", "start_pos": 10402951, "end_pos": 10401051, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0332553", "url": "https://www.ensembl.org/id/FBtr0332553" }, { "database": "Ensembl Peptide", "id": "FBpp0304811", "url": "https://www.ensembl.org/id/FBpp0304811" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "P83118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83118#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Crystal structure of the ectodomain of Methuselah, a Drosophila G protein-coupled receptor associated with extended lifespan.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "West AP Jr, Llamas LL, Snow PM, Benzer S, Bjorkman PJ", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "reference": [ { "type": "PubMed", "id": "11274391", "url": "https://glygen.org/publication/PubMed/11274391" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG31147", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG31147", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" }, { "name": "response to starvation", "id": "GO:0042594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042594", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" }, { "name": "determination of adult lifespan", "id": "GO:0008340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008340", "evidence": [ { "database": "UniProtKB", "id": "P83118", "url": "https://www.uniprot.org/uniprot/P83118" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" }, { "start_pos": 166, "end_pos": 168, "annotation": "n_glycosylation_sequon" }, { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" }, { "start_pos": 424, "end_pos": 426, "annotation": "n_glycosylation_sequon" }, { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 507, "end_pos": 509, "annotation": "n_glycosylation_sequon" }, { "start_pos": 515, "end_pos": 517, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }