{
    "uniprot_canonical_ac": "P70612-1",
    "uniprot_ac": "P70612",
    "uniprot_id": "CXCR1_RAT",
    "mass": {
        "chemical_mass": 39945.0,
        "monoisotopic_mass": 39945.0
    },
    "refseq": {
        "ac": "NP_062183",
        "name": "C-X-C chemokine receptor type 1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
    },
    "gene_names": [
        {
            "name": "Cxcr1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P70612",
            "id": "P70612"
        },
        {
            "name": "Cxcr1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183",
            "id": "NP_062183"
        },
        {
            "name": "IL-8R A; Il8ra",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183",
            "id": "NP_062183"
        },
        {
            "name": "Il8ra",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P70612",
            "id": "P70612"
        }
    ],
    "protein_names": [
        {
            "name": "C-X-C chemokine receptor type 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P70612"
        },
        {
            "name": "C-X-C chemokine receptor type 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183",
            "id": "NP_062183"
        },
        {
            "name": "CXC-R1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70612"
        },
        {
            "name": "CXCR-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70612"
        },
        {
            "name": "High affinity interleukin-8 receptor A",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70612"
        },
        {
            "name": "IL-8R A",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70612"
        },
        {
            "name": "high affinity interleukin-8 receptor A; interleukin 8 receptor, alpha; chemokine (C-X-C motif) receptor 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183",
            "id": "NP_062183"
        }
    ],
    "function": [
        {
            "annotation": "CXCR1 participates in bone cancer pain induced by Walker 256 breast cancer cells in female rats.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                },
                {
                    "database": "PubMed",
                    "id": "36227008",
                    "url": "https://glygen.org/publication/PubMed/36227008"
                }
            ]
        },
        {
            "annotation": "Findings indicate that acupuncture can increase the number of implanted embryos in embryo implantation failure, which may be relevant with up-regulation the expression of CXCL8 receptors CXCR1 and CXCR2 in endometrium.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                },
                {
                    "database": "PubMed",
                    "id": "24496685",
                    "url": "https://glygen.org/publication/PubMed/24496685"
                }
            ]
        },
        {
            "annotation": "May contribute to inflammation in experimental mesangioproliferative glomerulonephritis",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                },
                {
                    "database": "PubMed",
                    "id": "23336303",
                    "url": "https://glygen.org/publication/PubMed/23336303"
                }
            ]
        },
        {
            "annotation": "N-acetylated proline-glycine-proline induces premature senescence of nucleus pulposus cells through CXCR1-dependent DNA damage and Reactive Oxygen Species production which activates the p53-p21-Rb and p16-Rb pathways.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                },
                {
                    "database": "PubMed",
                    "id": "27769935",
                    "url": "https://glygen.org/publication/PubMed/27769935"
                }
            ]
        },
        {
            "annotation": "Potential role of the hydroxyl carboxylic acid receptor type 2 (HCAR2) in microglia pathophysiology: A possible cross-talk with C-X-C chemokine receptor 1 (CXCR1). Review article",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                },
                {
                    "database": "PubMed",
                    "id": "36796675",
                    "url": "https://glygen.org/publication/PubMed/36796675"
                }
            ]
        },
        {
            "annotation": "Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70612",
                    "url": "https://www.uniprot.org/uniprot/P70612#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "P25024",
                    "url": "https://www.uniprot.org/uniprot/P25024#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0080784",
            "recommended_name": {
                "id": "DOID:0080784",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0080784",
                "name": "urinary tract infection",
                "description": "An urinary system disease that is characterized by an infection in any part of the urinary system, including the kidneys, ureters, bladder or urethra."
            },
            "synonyms": [
                {
                    "id": "DOID:0080784",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0080784",
                    "name": "UTI",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "0080784",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0080784"
                }
            ]
        },
        {
            "disease_id": "DOID:11400",
            "recommended_name": {
                "id": "DOID:11400",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:11400",
                "name": "pyelonephritis",
                "description": ""
            },
            "synonyms": [],
            "evidence": [
                {
                    "id": "11400",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:11400"
                }
            ]
        },
        {
            "disease_id": "DOID:2920",
            "recommended_name": {
                "id": "DOID:2920",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:2920",
                "name": "membranoproliferative glomerulonephritis",
                "description": ""
            },
            "synonyms": [
                {
                    "id": "DOID:2920",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2920",
                    "name": "Lobular glomerulonephritis",
                    "description": ""
                },
                {
                    "id": "DOID:2920",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2920",
                    "name": "chronic glomerulonephritis, lobular",
                    "description": ""
                },
                {
                    "id": "MONDO:0010596",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010596",
                    "name": "membranoproliferative glomerulonephritis, X-linked",
                    "description": ""
                },
                {
                    "id": "MONDO:0010596",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010596",
                    "name": "membranoproliferative glomerulonephritis, X-linked",
                    "description": ""
                },
                {
                    "id": "MONDO:0010596",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010596",
                    "name": "Mesangiocapillary glomerulonephritis, X-linked",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "2920",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:2920"
                }
            ]
        },
        {
            "disease_id": "DOID:526",
            "recommended_name": {
                "id": "DOID:526",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:526",
                "name": "human immunodeficiency virus infectious disease",
                "description": "A viral infectious disease that results in destruction of immune system, leading to life-threatening opportunistic infections and cancers, has_material_basis_in Human immunodeficiency virus 1 or has_material_basis_in Human immunodeficiency virus 2, which are transmitted by sexual contact, transmitted by transfer of blood, semen, vaginal fluid, pre-ejaculate, or breast milk, transmitted by congenital method, and transmitted by contaminated needles. The virus infects helper T cells (CD4+ T cells) which are directly or indirectly destroyed, macrophages, and dendritic cells. The infection has symptom diarrhea, has symptom fatigue, has symptom fever, has symptom vaginal yeast infection, has symptom headache, has symptom mouth sores, has symptom muscle aches, has symptom sore throat, and has symptom swollen lymph glands."
            },
            "synonyms": [
                {
                    "id": "DOID:526",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:526",
                    "name": "HIV infection",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "526",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:526"
                }
            ]
        },
        {
            "disease_id": "DOID:783",
            "recommended_name": {
                "id": "DOID:783",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:783",
                "name": "end stage renal disease",
                "description": "A chronic kidney disease is characterized by non-functioning kidneys, as the final stage in chronic kidney disease."
            },
            "synonyms": [
                {
                    "id": "DOID:783",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:783",
                    "name": "end stage renal failure",
                    "description": ""
                },
                {
                    "id": "DOID:783",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:783",
                    "name": "end-stage kidney disease",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "783",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:783"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70612",
                    "url": "https://www.uniprot.org/uniprot/P70612"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "Cxcr1",
            "url": "https://www.uniprot.org/uniprot/P70612",
            "locus": {
                "chromosome": "9",
                "start_pos": 75766770,
                "end_pos": 75771084,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000048239",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000048239"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSRNOG00000048239",
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000048239",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd15178",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15178",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "54258",
            "url": "https://www.ncbi.nlm.nih.gov/gene/54258",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000174",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000174",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:54258",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:54258",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "SPVCYEV",
            "url": "https://omabrowser.org/oma/group/SPVCYEV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5347598at2759",
            "url": "http://www.orthodb.org/?query=5347598at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10489",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10489:SF916",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489:SF916",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00001",
            "url": "http://pfam.xfam.org/family/PF00001",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P70612",
            "url": "http://purl.obolibrary.org/obo/PR_P70612",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-RNO-380108",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-380108",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-RNO-418594",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-RNO-6798695",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_062183",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "2905",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2905",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P70612",
            "url": "https://www.uniprot.org/uniprot/P70612",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P70612-1",
            "url": "https://www.uniprot.org/uniprot/P70612-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLLGNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSLLKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFRQAYKPYRSGTVCYEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMRQKRRAMWVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGFSHSCLNPVIYAFVGQSFRHEFLKILANLVHKEVLTHHSASFRTSLTTIY",
        "length": 349,
        "header": "sp|P70612-1|CXCR1_RAT Isoform 1 of C-X-C chemokine receptor type 1  OS=Rattus norvegicus OX=10116 GN=Cxcr1 PE=3 SV=1 CANONICAL=P70612-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P70612-1",
            "url": "",
            "sequence": {
                "sequence": "MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLLGNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSLLKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFRQAYKPYRSGTVCYEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMRQKRRAMWVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGFSHSCLNPVIYAFVGQSFRHEFLKILANLVHKEVLTHHSASFRTSLTTIY",
                "length": 349,
                "header": "sp|P70612-1|CXCR1_RAT Isoform 1 of C-X-C chemokine receptor type 1  OS=Rattus norvegicus OX=10116 GN=Cxcr1 PE=3 SV=1 CANONICAL=P70612-1"
            },
            "locus": {
                "chromosome": "9",
                "start_pos": 75769362,
                "end_pos": 75768316,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000090868",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000090868"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000070273",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000070273"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 22,
            "start_aa": "Asn",
            "end_pos": 22,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn22",
            "evidence": [
                {
                    "id": "P70612",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P70612#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Role of CXCR1 (CKR-1) in inflammation of experimental mesangioproliferative glomerulonephritis.",
            "journal": "Renal failure",
            "date": "2013",
            "authors": "Ozaltin F, Besbas N, Iskit AB, Cil O, Akcoren Z, Kale G, Bakkaloglu A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23336303",
                    "url": "https://glygen.org/publication/PubMed/23336303"
                }
            ]
        },
        {
            "title": "Effect of acupuncture on CXCL8 receptors in rats suffering from embryo implantation failure.",
            "journal": "Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban",
            "date": "2014",
            "authors": "Gao WN, Yang W, Liu YF, Tang X, Guo Y, Wang LJ, Zhang MM, Huang GY",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24496685",
                    "url": "https://glygen.org/publication/PubMed/24496685"
                }
            ]
        },
        {
            "title": "The matrikine N-acetylated proline-glycine-proline induces premature senescence of nucleus pulposus cells via CXCR1-dependent ROS accumulation and DNA damage and reinforces the destructive effect of these cells on homeostasis of intervertebral discs.",
            "journal": "Biochimica et biophysica acta. Molecular basis of disease",
            "date": "2017",
            "authors": "Feng C, Zhang Y, Yang M, Lan M, Liu H, Wang J, Zhou Y, Huang B",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27769935",
                    "url": "https://glygen.org/publication/PubMed/27769935"
                }
            ]
        },
        {
            "title": "CXCR1 participates in bone cancer pain induced by Walker 256 breast cancer cells in female rats.",
            "journal": "Molecular pain",
            "date": "2022-04",
            "authors": "Xu Chengfei, Zhao Baoxia, Xu Longsheng, Wang Yahui, Liu Beibei, Xu Miao, He Qiuli, Ni Chaobo, Fu Jie, Kong Min, Lin Xuewu, Ni Huadong, Yao Ming",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36227008",
                    "url": "https://glygen.org/publication/PubMed/36227008"
                }
            ]
        },
        {
            "title": "Potential role of the hydroxyl carboxylic acid receptor type 2 (HCAR2) in microglia pathophysiology: A possible cross-talk with C-X-C chemokine receptor 1 (CXCR1).",
            "journal": "Neuropharmacology",
            "date": "2023-05-01",
            "authors": "Perrone Michela, Pagano Martina, Belardo Carmela, Ricciardi Flavia, Ricciardi Federica, Fusco Antimo, Trotta Maria Consiglia, Infantino Rosmara, Gargano Francesca, Parente Andrea, Giacca Rosa, Pieretti Gorizio, Luongo Livio, Maione Sabatino, Boccella Serena, Guida Francesca",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_062183",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062183"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36796675",
                    "url": "https://glygen.org/publication/PubMed/36796675"
                }
            ]
        },
        {
            "title": "Identification of two rat genes orthologous to the human interleukin-8 receptors.",
            "journal": "J. Biol. Chem.",
            "date": "1996",
            "authors": "Feng L., Xia Y., Adhikari S., Harrison J.K., Dunstan C.-A.N., Salafranca M.N.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70612",
                    "url": "https://www.uniprot.org/uniprot/P70612"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8955112",
                    "url": "https://glygen.org/publication/PubMed/8955112"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:54258",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:54258",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-RNO-380108",
            "name": "Chemokine receptors bind chemokines",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-380108",
            "resource": "Reactome",
            "description": "Chemokine receptors bind chemokines"
        },
        {
            "id": "R-RNO-418594",
            "name": "G alpha (i) signalling events",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594",
            "resource": "Reactome",
            "description": "G alpha (i) signalling events"
        },
        {
            "id": "R-RNO-6798695",
            "name": "Neutrophil degranulation",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695",
            "resource": "Reactome",
            "description": "Neutrophil degranulation"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P25024-1",
            "protein_name": "C-X-C chemokine receptor type 1",
            "gene_name": "CXCR1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL",
                "length": 350
            },
            "evidence": [
                {
                    "id": "45239388",
                    "url": "http://www.informatics.jax.org/homology/45239388",
                    "database": "MGI"
                },
                {
                    "id": "P70612",
                    "url": "https://omabrowser.org/oma/group/P70612/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q810W6-1",
            "protein_name": "C-X-C chemokine receptor type 1",
            "gene_name": "Cxcr1",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDTCERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAIY",
                "length": 351
            },
            "evidence": [
                {
                    "id": "45239388",
                    "url": "http://www.informatics.jax.org/homology/45239388",
                    "database": "MGI"
                },
                {
                    "id": "P70612",
                    "url": "https://omabrowser.org/oma/group/P70612/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 6,
                "go_terms": [
                    {
                        "name": "immune response",
                        "id": "GO:0006955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell surface receptor signaling pathway",
                        "id": "GO:0007166",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cytosolic calcium ion concentration",
                        "id": "GO:0007204",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "calcium-mediated signaling",
                        "id": "GO:0019722",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "receptor internalization",
                        "id": "GO:0031623",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031623",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "neutrophil chemotaxis",
                        "id": "GO:0030593",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "C-C chemokine receptor activity",
                        "id": "GO:0016493",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016493",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "C-C chemokine binding",
                        "id": "GO:0019957",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019957",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "interleukin-8 binding",
                        "id": "GO:0019959",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019959",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "interleukin-8 receptor activity",
                        "id": "GO:0004918",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004918",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "external side of plasma membrane",
                        "id": "GO:0009897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70612",
                                "url": "https://www.uniprot.org/uniprot/P70612"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 22,
            "end_pos": 24,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 6
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}