{ "uniprot_canonical_ac": "P70434-1", "uniprot_ac": "P70434", "uniprot_id": "IRF7_MOUSE", "mass": { "chemical_mass": 51222.0, "monoisotopic_mass": 51222.0 }, "refseq": { "ac": "NP_001239529", "name": "interferon regulatory factor 7 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" }, "gene_names": [ { "name": "Irf7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P70434", "id": "P70434" }, { "name": "Irf7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546", "id": "NP_058546" } ], "protein_names": [ { "name": "Interferon regulatory factor 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P70434" }, { "name": "IRF-7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530", "id": "NP_001239530" }, { "name": "IRF-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P70434" }, { "name": "interferon regulatory factor 7 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546", "id": "NP_058546" }, { "name": "interferon regulatory factor 7 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529", "id": "NP_001239529" }, { "name": "interferon regulatory factor 7 isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530", "id": "NP_001239530" } ], "function": [ { "annotation": "Astrocytes evoke a robust IRF7-independent type I interferon response upon neurotropic viral infection. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "PubMed", "id": "37737190", "url": "https://glygen.org/publication/PubMed/37737190" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ] }, { "annotation": "Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:27129230, PubMed:22095711). Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction via both the virus-activated, MyD88-independent pathway and the TLR-activated, MyD88-dependent pathway. Induces transcription of ubiquitin hydrolase USP25 mRNA in response to lipopolysaccharide (LPS) or viral infection in a type I IFN-dependent manner (PubMed:27129230). Required during both the early and late phases of the IFN gene induction but is more critical for the late than for the early phase. Exists in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, becomes phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization where along with other coactivators it can activate transcription of the type I IFN and ISG genes. Can also play a role in regulating adaptive immune responses by inducing PSMB9/LMP2 expression, either directly or through induction of IRF1. Binds to the Q promoter (Qp) of EBV nuclear antigen 1 a (EBNA1) and may play a role in the regulation of EBV latency. Can activate distinct gene expression programs in macrophages and regulate the anti-tumor properties of primary macrophages.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434#function" }, { "database": "PubMed", "id": "15361868", "url": "https://glygen.org/publication/PubMed/15361868" }, { "database": "PubMed", "id": "15800576", "url": "https://glygen.org/publication/PubMed/15800576" }, { "database": "PubMed", "id": "22095711", "url": "https://glygen.org/publication/PubMed/22095711" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "PubMed", "id": "27129230", "url": "https://glygen.org/publication/PubMed/27129230" }, { "database": "PubMed", "id": "18562536", "url": "https://glygen.org/publication/PubMed/18562536" } ] }, { "annotation": "TLR-mediated IFN-alpha induction requires the formation of a complex consisting of MyD88, TRAF6 and IRF7 as well as TRAF6-dependent ubiquitination.", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "PubMed", "id": "15361868", "url": "https://glygen.org/publication/PubMed/15361868" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ] }, { "annotation": "TRIM21 Promotes Rabies Virus Production by Degrading IRF7 through Ubiquitination. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "PubMed", "id": "37446070", "url": "https://glygen.org/publication/PubMed/37446070" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ] }, { "annotation": "Transcription factor IRF-7 interacts with MyD88 to form a complex in the cytoplasm", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "PubMed", "id": "15492225", "url": "https://glygen.org/publication/PubMed/15492225" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ] }, { "annotation": "XAF1 prevents hyperproduction of type I interferon upon viral infection by targeting IRF7.", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "PubMed", "id": "36394357", "url": "https://glygen.org/publication/PubMed/36394357" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ] } ], "disease": [ { "disease_id": "DOID:0111969", "recommended_name": { "id": "DOID:0111969", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111969", "name": "immunodeficiency 39", "description": "A primary immunodeficiency disease characterized by impaired interferon I and III production in response to influenza virus infection that has_material_basis_in homozygous or compond heterozygous mutation in the IRF7 gene on chromosome 11p15.5." }, "synonyms": [ { "id": "DOID:0111969", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111969", "name": "IMD39", "description": "" }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "immunodeficiency 39", "description": "Any primary immunodeficiency disease in which the cause of the disease is a mutation in the IRF7 gene." }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "IRF7 primary immunodeficiency disease", "description": "" }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "immunodeficiency 39", "description": "" }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "immunodeficiency type 39", "description": "" }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "primary immunodeficiency disease caused by mutation in IRF7", "description": "" }, { "id": "MONDO:0014597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014597", "name": "IMD39", "description": "" }, { "id": "MIM:616345", "resource": "MIM", "url": "https://www.omim.org/entry/616345", "name": "Immunodeficiency 39", "description": "Immunodeficiency 39" } ], "evidence": [ { "id": "0111969", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111969" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 425, "end_pos": 425, "sequence_org": "S", "sequence_mut": "A", "comment": "Strongly decreased transcriptional activation in response to viral infection; when associated with A-426.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 425, "end_pos": 425, "sequence_org": "S", "sequence_mut": "D", "comment": "Strongly decreased transcriptional activation in response to viral infection; when associated with D-426.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 426, "end_pos": 426, "sequence_org": "S", "sequence_mut": "A", "comment": "Strongly decreased transcriptional activation in response to viral infection; when associated with A-425.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 426, "end_pos": 426, "sequence_org": "S", "sequence_mut": "D", "comment": "Strongly decreased transcriptional activation in response to viral infection; when associated with D-425.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 427, "end_pos": 427, "sequence_org": "L", "sequence_mut": "A", "comment": "Strongly decreased transcriptional activation in response to viral infection.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 427, "end_pos": 427, "sequence_org": "L", "sequence_mut": "D", "comment": "No effect on transcriptional activation in response to viral infection.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 429, "end_pos": 431, "sequence_org": "SSS", "sequence_mut": "AAA", "comment": "Almost no effect on transcriptional activation in response to viral infection.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 429, "end_pos": 431, "sequence_org": "SSS", "sequence_mut": "DDD", "comment": "Strongly increased transcriptional activation in response to viral infection.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 437, "end_pos": 437, "sequence_org": "S", "sequence_mut": "A", "comment": "Almost complete loss of transcriptional activation; when associated with A-438.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 437, "end_pos": 437, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased transcriptional activation; when associated with D-438.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 438, "end_pos": 438, "sequence_org": "S", "sequence_mut": "A", "comment": "Almost complete loss of transcriptional activation; when associated with A-437.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 438, "end_pos": 438, "sequence_org": "S", "sequence_mut": "D", "comment": "Increased transcriptional activation; when associated with D-437.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "start_pos": 441, "end_pos": 441, "sequence_org": "S", "sequence_mut": "A", "comment": "Almost no effect on transcriptional activation in response to viral infection.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Irf7", "url": "https://www.uniprot.org/uniprot/P70434", "locus": { "chromosome": "7", "start_pos": 140842619, "end_pos": 140846394, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000025498", "url": "https://www.ensembl.org/id/ENSMUSG00000025498" } ] } } ], "crossref": [ { "id": "ENSMUSG00000025498", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000025498", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00103", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00103", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "54123", "url": "https://www.ncbi.nlm.nih.gov/gene/54123", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P70434", "url": "https://www.ebi.ac.uk/intact/interactors/id:P70434*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001346", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001346", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008984", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008984", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019817", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019817", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:54123", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:54123", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1859212", "url": "http://www.informatics.jax.org/marker/MGI:1859212", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WLDEAHT", "url": "https://omabrowser.org/oma/group/WLDEAHT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3740806at2759", "url": "http://www.orthodb.org/?query=3740806at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11949", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11949", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11949:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11949:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3QU3", "url": "https://www.rcsb.org/structure/3QU3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00605", "url": "http://pfam.xfam.org/family/PF00605", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10401", "url": "http://pfam.xfam.org/family/PF10401", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P70434", "url": "http://purl.obolibrary.org/obo/PR_P70434", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-3134963", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3134963", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-918233", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-918233", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-933541", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-933541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-936964", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-975110", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-975110", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GRH7", "url": "https://www.uniprot.org/uniprot/A0A1B0GRH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GRH7-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GRH7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z4U9", "url": "https://www.uniprot.org/uniprot/D3Z4U9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z4U9-1", "url": "https://www.uniprot.org/uniprot/D3Z4U9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6TQ89", "url": "https://www.uniprot.org/uniprot/F6TQ89", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6TQ89-1", "url": "https://www.uniprot.org/uniprot/F6TQ89-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P70434-1", "url": "https://www.uniprot.org/uniprot/P70434-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TW14", "url": "https://www.uniprot.org/uniprot/Q3TW14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TW14-1", "url": "https://www.uniprot.org/uniprot/Q3TW14-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTVGPATENREEVSLSNALPTQGVSPGSFLARENAGLQTPSPLLSSDAGDLLLQVLQYSHILESESGADPVPPQAPGQEQDRVYEEPYAAWQVEAVPSPRPQQPALTERSLGFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKLEPWVCKAYLEGVQREGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP", "length": 457, "header": "sp|P70434-1|IRF7_MOUSE Isoform 1 of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GRH7-1", "url": "", "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTGSAVQPHTGIRVWGRPRPTTGSWPGARPCLRGTLCSMAGGSCPQSQASTASSHRAQPWVPGCDHHVQGPHSATGSGGAPQMRVPVQPHGPSSKNFRAPAGDLSQSC", "length": 237, "header": "tr|A0A1B0GRH7-1|A0A1B0GRH7_MOUSE Computationally mapped isoform of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "locus": { "chromosome": "7", "start_pos": 140845549, "end_pos": 140843805, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000209899.2", "url": "https://www.ensembl.org/id/ENSMUST00000209899.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147529.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147529.2" } ] } }, { "isoform_ac": "D3Z4U9-1", "url": "", "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTVGPATENREEVSLSNALPTQVLQYSHILESESGADPVPPQAPGQEQDRVYEEPYAAWQVEAVPSPRPQQPALTERSLGFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKLEPWVCKAYLEGVQREGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP", "length": 425, "header": "tr|D3Z4U9-1|D3Z4U9_MOUSE Computationally mapped isoform of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "locus": { "chromosome": "7", "start_pos": 140845549, "end_pos": 140843141, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000106023.8", "url": "https://www.ensembl.org/id/ENSMUST00000106023.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101644.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101644.2" } ] } }, { "isoform_ac": "F6TQ89-1", "url": "", "sequence": { "sequence": "XAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTERSLGFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKVEPGWAKG", "length": 251, "header": "tr|F6TQ89-1|F6TQ89_MOUSE Computationally mapped isoform of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "locus": { "chromosome": "7", "start_pos": 140845205, "end_pos": 140843345, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000123525.2", "url": "https://www.ensembl.org/id/ENSMUST00000123525.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121026.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121026.2" } ] } }, { "isoform_ac": "P70434-1", "url": "", "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTVGPATENREEVSLSNALPTQGVSPGSFLARENAGLQTPSPLLSSDAGDLLLQVLQYSHILESESGADPVPPQAPGQEQDRVYEEPYAAWQVEAVPSPRPQQPALTERSLGFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKLEPWVCKAYLEGVQREGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP", "length": 457, "header": "sp|P70434-1|IRF7_MOUSE Isoform 1 of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "locus": { "chromosome": "7", "start_pos": 140845549, "end_pos": 140843141, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000026571", "url": "https://www.ensembl.org/id/ENSMUST00000026571" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000026571", "url": "https://www.ensembl.org/id/ENSMUSP00000026571" } ] } }, { "isoform_ac": "Q3TW14-1", "url": "", "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGSTVGPATENREEVSLSNALPTQGVSPGSFLARENAGLQTPSPLLSSDAGDLLLQVLQYSHILESESGADPVPPQAPERSLGFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKLEPWVCKAYLEGVQREGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP", "length": 426, "header": "tr|Q3TW14-1|Q3TW14_MOUSE Computationally mapped isoform of Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1 CANONICAL=P70434-1" }, "locus": { "chromosome": "7", "start_pos": 140845549, "end_pos": 140843141, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000097952.9", "url": "https://www.ensembl.org/id/ENSMUST00000097952.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000095565.3", "url": "https://www.ensembl.org/id/ENSMUSP00000095565.3" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 425, "end_pos": 425, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "site_lbl": "Ser425" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "site_lbl": "Ser426" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "site_lbl": "Ser429" }, { "start_pos": 431, "end_pos": 431, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1 and IKKE", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "site_lbl": "Ser431" }, { "start_pos": 437, "end_pos": 437, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" }, { "database": "PubMed", "id": "30131810", "url": "https://glygen.org/publication/PubMed/30131810" }, { "database": "PubMed", "id": "31603949", "url": "https://glygen.org/publication/PubMed/31603949" } ], "site_lbl": "Ser437" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" }, { "database": "PubMed", "id": "30131810", "url": "https://glygen.org/publication/PubMed/30131810" }, { "database": "PubMed", "id": "31603949", "url": "https://glygen.org/publication/PubMed/31603949" } ], "site_lbl": "Ser438" }, { "start_pos": 441, "end_pos": 441, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "site_lbl": "Ser441" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Structure and function of IRF-7.", "journal": "J. Interferon Cytokine Res.", "date": "2002", "authors": "Zhang L., Pagano J.S.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "11846980", "url": "https://glygen.org/publication/PubMed/11846980" } ] }, { "title": "Interferon-alpha induction through Toll-like receptors involves a direct interaction of IRF7 with MyD88 and TRAF6.", "journal": "Nat. Immunol.", "date": "2004", "authors": "Kawai T, Sato S, Ishii KJ, Coban C, Hemmi H, Yamamoto M, Terai K, Matsuda M, Inoue J, Uematsu S, Takeuchi O, Akira S", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ], "reference": [ { "type": "PubMed", "id": "15361868", "url": "https://glygen.org/publication/PubMed/15361868" } ] }, { "title": "Role of a transductional-transcriptional processor complex involving MyD88 and IRF-7 in Toll-like receptor signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Honda K, Yanai H, Mizutani T, Negishi H, Shimada N, Suzuki N, Ohba Y, Takaoka A, Yeh WC, Taniguchi T", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" } ], "reference": [ { "type": "PubMed", "id": "15492225", "url": "https://glygen.org/publication/PubMed/15492225" } ] }, { "title": "Regulatory serine residues mediate phosphorylation-dependent and phosphorylation-independent activation of interferon regulatory factor 7.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Caillaud A, Hovanessian AG, Levy DE, Marie IJ", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "reference": [ { "type": "PubMed", "id": "15743772", "url": "https://glygen.org/publication/PubMed/15743772" } ] }, { "title": "IRF-7 is the master regulator of type-I interferon-dependent immune responses.", "journal": "Nature", "date": "2005", "authors": "Honda K, Yanai H, Negishi H, Asagiri M, Sato M, Mizutani T, Shimada N, Ohba Y, Takaoka A, Yoshida N, Taniguchi T", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "15800576", "url": "https://glygen.org/publication/PubMed/15800576" } ] }, { "title": "Distinct functions of IRF-3 and IRF-7 in IFN-alpha gene regulation and control of anti-tumor activity in primary macrophages.", "journal": "Biochem. Pharmacol.", "date": "2006", "authors": "Solis M, Goubau D, Romieu-Mourez R, Genin P, Civas A, Hiscott J", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "16846591", "url": "https://glygen.org/publication/PubMed/16846591" } ] }, { "title": "Type I interferon gene induction by the interferon regulatory factor family of transcription factors.", "journal": "Immunity", "date": "2006", "authors": "Honda K., Taniguchi T., Takaoka A.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "16979567", "url": "https://glygen.org/publication/PubMed/16979567" } ] }, { "title": "Interferon regulatory factor IRF-7 induces the antiviral alpha interferon response and protects against lethal West Nile virus infection.", "journal": "J. Virol.", "date": "2008", "authors": "Diamond M.S., Gale M. Jr., Keller B.C., Daffis S., Suthar M.S., Samuel M.A.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "18562536", "url": "https://glygen.org/publication/PubMed/18562536" } ] }, { "title": "Regulation of immunity and oncogenesis by the IRF transcription factor family.", "journal": "Cancer Immunol. Immunother.", "date": "2010", "authors": "Tamura T., Yanai H., Taniguchi T., Savitsky D.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "20049431", "url": "https://glygen.org/publication/PubMed/20049431" } ] }, { "title": "IRF7: activation, regulation, modification and function.", "journal": "Genes Immun.", "date": "2011", "authors": "Barber G.N., Ning S., Pagano J.S.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "21490621", "url": "https://glygen.org/publication/PubMed/21490621" } ] }, { "title": "Guanylate binding protein 4 negatively regulates virus-induced type I IFN and antiviral response by targeting IFN regulatory factor 7.", "journal": "J. Immunol.", "date": "2011", "authors": "Hu Y, Wang J, Yang B, Zheng N, Qin M, Ji Y, Lin G, Tian L, Wu X, Wu L, Sun B", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "22095711", "url": "https://glygen.org/publication/PubMed/22095711" } ] }, { "title": "Negative regulation of Nmi on virus-triggered type I IFN production by targeting IRF7.", "journal": "J. Immunol.", "date": "2013", "authors": "Wang J, Yang B, Hu Y, Zheng Y, Zhou H, Wang Y, Ma Y, Mao K, Yang L, Lin G, Ji Y, Wu X, Sun B", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "23956435", "url": "https://glygen.org/publication/PubMed/23956435" } ] }, { "title": "The Type I Interferon-IRF7 Axis Mediates Transcriptional Expression of Usp25 Gene.", "journal": "J. Biol. Chem.", "date": "2016", "authors": "Ren Y, Zhao Y, Lin D, Xu X, Zhu Q, Yao J, Shu HB, Zhong B", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "reference": [ { "type": "PubMed", "id": "27129230", "url": "https://glygen.org/publication/PubMed/27129230" } ] }, { "title": "Blimp-1-Mediated Pathway Promotes Type I IFN Production in Plasmacytoid Dendritic Cells by Targeting to Interleukin-1 Receptor-Associated Kinase M.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Ko YA, Chan YH, Liu CH, Liang JJ, Chuang TH, Hsueh YP, Lin YL, Lin KI", "evidence": [ { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "reference": [ { "type": "PubMed", "id": "30131810", "url": "https://glygen.org/publication/PubMed/30131810" } ] }, { "title": "P200 family protein IFI204 negatively regulates type I interferon responses by targeting IRF7 in nucleus.", "journal": "PLoS pathogens", "date": "2019", "authors": "Cao L, Ji Y, Zeng L, Liu Q, Zhang Z, Guo S, Guo X, Tong Y, Zhao X, Li CM, Chen Y, Guo D", "evidence": [ { "database": "iPTMnet", "id": "P70434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70434" } ], "reference": [ { "type": "PubMed", "id": "31603949", "url": "https://glygen.org/publication/PubMed/31603949" } ] }, { "title": "XAF1 prevents hyperproduction of type I interferon upon viral infection by targeting IRF7.", "journal": "EMBO reports", "date": "2022-11-17", "authors": "Liu Bao-Qin, Liu Rong-Bei, Li Wen-Ping, Mao Xin-Tao, Li Yi-Ning, Huang Tao, Wang Hao-Li, Chen Hao-Tian, Zhong Jiang-Yan, Yang Bing, Chai Ren-Jie, Cao Qian, Jin Jin, Li Yi-Yuan", "evidence": [ { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" }, { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" } ], "reference": [ { "type": "PubMed", "id": "36394357", "url": "https://glygen.org/publication/PubMed/36394357" } ] }, { "title": "TRIM21 Promotes Rabies Virus Production by Degrading IRF7 through Ubiquitination.", "journal": "International journal of molecular sciences", "date": "2023-06-30", "authors": "Zhang Boyue, Cai Ting, He Hongling, Huang Xuezhe, Chen Guie, Lai Yanqin, Luo Yongwen, Huang Shile, Luo Jun, Guo Xiaofeng", "evidence": [ { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" }, { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" } ], "reference": [ { "type": "PubMed", "id": "37446070", "url": "https://glygen.org/publication/PubMed/37446070" } ] }, { "title": "Astrocytes evoke a robust IRF7-independent type I interferon response upon neurotropic viral infection.", "journal": "Journal of neuroinflammation", "date": "2023-09-22", "authors": "Weichert Loreen, D\u00fcsedau Henning Peter, Fritzsch David, Schreier Sarah, Scharf Annika, Grashoff Martina, Cebulski Kristin, Michaelsen-Preusse Kristin, Erck Christian, Lienenklaus Stefan, Dunay Ildiko Rita, Kr\u00f6ger Andrea", "evidence": [ { "database": "RefSeq", "id": "NP_001239530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239530" }, { "database": "RefSeq", "id": "NP_001239529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239529" }, { "database": "RefSeq", "id": "NP_058546", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058546" } ], "reference": [ { "type": "PubMed", "id": "37737190", "url": "https://glygen.org/publication/PubMed/37737190" } ] } ], "pathway": [ { "id": "mmu:54123", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:54123", "resource": "KEGG Pathway" }, { "id": "R-MMU-3134963", "name": "DEx/H-box helicases activate type I IFN and inflammatory cytokines production", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3134963", "resource": "Reactome", "description": "DEx/H-box helicases activate type I IFN and inflammatory cytokines production" }, { "id": "R-MMU-9013973", "name": "TICAM1-dependent activation of IRF3/IRF7", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013973", "resource": "Reactome", "description": "TICAM1-dependent activation of IRF3/IRF7" }, { "id": "R-MMU-918233", "name": "TRAF3-dependent IRF activation pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-918233", "resource": "Reactome", "description": "TRAF3-dependent IRF activation pathway" }, { "id": "R-MMU-933541", "name": "TRAF6 mediated IRF7 activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-933541", "resource": "Reactome", "description": "TRAF6 mediated IRF7 activation" }, { "id": "R-MMU-936964", "name": "Activation of IRF3, IRF7 mediated by TBK1, IKBKE", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-936964", "resource": "Reactome", "description": "Activation of IRF3, IRF7 mediated by TBK1, IKBKE" }, { "id": "R-MMU-975110", "name": "TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-975110", "resource": "Reactome", "description": "TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3SWU2-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "Irf7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAEVRGVQRVLFGDWLLGEVSSGRYEGLQWLNEAHTVFRVPWKHFSRRDLDEADAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRGWKTNFRCALRSTGRFILRQDNSGDPADPHKVYELSPELGSTTGPALENREEVTLSSALPTQGMSLGSFLARGNAGLQTPSPLLSGDAGDLLLQVLQYSHLLDSESRADSVPPQASGQEQEHLPEEPHAAWQMEATSSPRLQHPVLMTERNLGSLDVTIMYKGRTVLQAMVGHPRCVFLYSPVGSAIRTSEPQPVIFPSPAELPDQKQLHYTETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGSTNPSTPAQLLERNCHTPIFDFSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKSLILVKLEPWLCKTHLEGVQREGVSSLDSSSLGLCLSSTNSLYDDIEHFLMDLGQWA", "length": 455 }, "evidence": [ { "id": "45232213", "url": "http://www.informatics.jax.org/homology/45232213", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA", "length": 503 }, "evidence": [ { "id": "45232213", "url": "http://www.informatics.jax.org/homology/45232213", "database": "MGI" }, { "id": "P70434", "url": "https://omabrowser.org/oma/group/P70434/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "positive regulation of interferon-alpha production", "id": "GO:0032727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032727", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of MyD88-dependent toll-like receptor signaling pathway", "id": "GO:0034124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034124", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of MyD88-independent toll-like receptor signaling pathway", "id": "GO:0034127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034127", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "positive regulation of type I interferon production", "id": "GO:0032481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032481", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "positive regulation of type I interferon-mediated signaling pathway", "id": "GO:0060340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060340", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of adaptive immune response", "id": "GO:0002819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002819", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "regulation of innate immune response", "id": "GO:0045088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045088", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "positive regulation of interferon-beta production", "id": "GO:0032728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032728", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "cis-regulatory region sequence-specific DNA binding", "id": "GO:0000987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000987", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "'Lys-63'-linked ubiquitination by NEURL3 promotes IRF7 activation.", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "Q92985", "url": "https://glygen.org/publication/PubMed/Q92985" } ] }, { "annotation": "TRAF6-mediated ubiquitination is required for IRF7 activation (PubMed:15361868, PubMed:22095711). TRIM35 mediates IRF7 'Lys-48'-linked polyubiquitination and subsequent proteasomal degradation (By similarity). 'Lys-48'-linked polyubiquitination and subsequent proteasomal degradation is NMI-dependent in response to Sendai virus infection (PubMed:23956435). Ubiquitinated by UBE3C, leading to its degradation (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P70434", "url": "https://www.uniprot.org/uniprot/P70434" }, { "database": "PubMed", "id": "15361868", "url": "https://glygen.org/publication/PubMed/15361868" }, { "database": "PubMed", "id": "Q92985", "url": "https://glygen.org/publication/PubMed/Q92985" }, { "database": "PubMed", "id": "22095711", "url": "https://glygen.org/publication/PubMed/22095711" }, { "database": "PubMed", "id": "23956435", "url": "https://glygen.org/publication/PubMed/23956435" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }