{
    "uniprot_canonical_ac": "P70186-1",
    "uniprot_ac": "P70186",
    "uniprot_id": "EPYC_MOUSE",
    "mass": {
        "chemical_mass": 36763.0,
        "monoisotopic_mass": 36763.0
    },
    "refseq": {
        "ac": "NP_031910",
        "name": "epiphycan precursor",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910"
    },
    "gene_names": [
        {
            "name": "Epyc",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P70186",
            "id": "P70186"
        },
        {
            "name": "Dspg3; PG-Lb; SLRR3B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910",
            "id": "NP_031910"
        },
        {
            "name": "Dspg3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P70186",
            "id": "P70186"
        },
        {
            "name": "Epyc",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910",
            "id": "NP_031910"
        },
        {
            "name": "Pglb",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P70186",
            "id": "P70186"
        }
    ],
    "protein_names": [
        {
            "name": "Epiphycan",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P70186"
        },
        {
            "name": "Dermatan sulfate proteoglycan 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70186"
        },
        {
            "name": "PG-Lb",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70186"
        },
        {
            "name": "Proteoglycan-Lb",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70186"
        },
        {
            "name": "Small chondroitin/dermatan sulfate proteoglycan",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P70186"
        },
        {
            "name": "epiphycan precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910",
            "id": "NP_031910"
        },
        {
            "name": "proteoglycan-Lb; dermatan sulfate proteoglycan 3; small chondroitin/dermatan sulfate proteoglycan; dermatan sulphate proteoglycan 3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910",
            "id": "NP_031910"
        }
    ],
    "function": [
        {
            "annotation": "Epyc is necessary for normal auditory function",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_031910",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910"
                },
                {
                    "database": "PubMed",
                    "id": "28864419",
                    "url": "https://glygen.org/publication/PubMed/28864419"
                }
            ]
        },
        {
            "annotation": "May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Epyc",
            "url": "https://www.uniprot.org/uniprot/P70186",
            "locus": {
                "chromosome": "10",
                "start_pos": 97518316,
                "end_pos": 97479930,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000019936",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000019936"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000019936",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019936",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "13516",
            "url": "https://www.ncbi.nlm.nih.gov/gene/13516",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000372",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000372",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001611",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003591",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003591",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR032675",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR043547",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR043547",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:13516",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13516",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "107942",
            "url": "http://www.informatics.jax.org/marker/MGI:107942",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "NFISEIH",
            "url": "https://omabrowser.org/oma/group/NFISEIH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1080036at2759",
            "url": "http://www.orthodb.org/?query=1080036at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46269",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46269",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46269:SF3",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46269:SF3",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13855",
            "url": "http://pfam.xfam.org/family/PF13855",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P70186",
            "url": "http://purl.obolibrary.org/obo/PR_P70186",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_031910",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P70186",
            "url": "https://www.uniprot.org/uniprot/P70186",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P70186-1",
            "url": "https://www.uniprot.org/uniprot/P70186-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGMLARVALGLIIIDAVLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNHVENEKVSERLSGNRELLTPGPQLGDNQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKKTTYFYSRFNRIKKINKNDFASLNDLKRIDLTSNLISEIDEDAFRKLPHLQELVLRDNKIKQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYITDNSLDHIPLPLPESLRALHLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNPINLSRTPQAYMCLPRLPIGSFI",
        "length": 322,
        "header": "sp|P70186-1|EPYC_MOUSE Isoform 1 of Epiphycan  OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1 CANONICAL=P70186-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P70186-1",
            "url": "",
            "sequence": {
                "sequence": "MGMLARVALGLIIIDAVLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNHVENEKVSERLSGNRELLTPGPQLGDNQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKKTTYFYSRFNRIKKINKNDFASLNDLKRIDLTSNLISEIDEDAFRKLPHLQELVLRDNKIKQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYITDNSLDHIPLPLPESLRALHLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNPINLSRTPQAYMCLPRLPIGSFI",
                "length": 322,
                "header": "sp|P70186-1|EPYC_MOUSE Isoform 1 of Epiphycan  OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1 CANONICAL=P70186-1"
            },
            "locus": {
                "chromosome": "10",
                "start_pos": 97517129,
                "end_pos": 97485562,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000020094",
                        "url": "https://www.ensembl.org/id/ENSMUST00000020094"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000020094",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000020094"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 283,
            "start_aa": "Asn",
            "end_pos": 283,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn283",
            "evidence": [
                {
                    "id": "P70186",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P70186#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 302,
            "start_aa": "Asn",
            "end_pos": 302,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn302",
            "evidence": [
                {
                    "id": "P70186",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P70186#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "O-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "S",
            "relation": "attached",
            "comment": "O-linked (Xyl...) (dermatan sulfate) serine",
            "start_pos": 64,
            "start_aa": "Ser",
            "end_pos": 64,
            "end_aa": "Ser",
            "residue": "Ser",
            "site_lbl": "Ser64",
            "evidence": [
                {
                    "id": "P70186",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P70186#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "O-linked",
            "subtype": "O-GalNAcylation",
            "site_category": "predicted",
            "site_seq": "S",
            "relation": "attached",
            "comment": "O-linked (GalNAc...) serine O-GalNAcylation",
            "start_pos": 96,
            "start_aa": "Ser",
            "end_pos": 96,
            "end_aa": "Ser",
            "residue": "Ser",
            "site_lbl": "Ser96",
            "evidence": [
                {
                    "id": "P70186",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P70186#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Expression and localization of PG-Lb/epiphycan during mouse development.",
            "journal": "Dev. Dyn.",
            "date": "1999",
            "authors": "Eberspaecher H., Hoeoek M., Shinomura T., Johnson H.J., Decrombrugghe B., Pinero G.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10633869",
                    "url": "https://glygen.org/publication/PubMed/10633869"
                }
            ]
        },
        {
            "title": "Epiphycan is specifically expressed in cochlear supporting cells and is necessary for normal hearing.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2017",
            "authors": "Hanada Y, Nakamura Y, Ishida Y, Takimoto Y, Taniguchi M, Ozono Y, Koyama Y, Morihana T, Imai T, Ota Y, Sato T, Inohara H, Shimada S",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_031910",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28864419",
                    "url": "https://glygen.org/publication/PubMed/28864419"
                }
            ]
        },
        {
            "title": "Occurrence of PG-Lb, a leucine-rich small chondroitin/dermatan sulphate proteoglycan in mammalian epiphyseal cartilage: molecular cloning and sequence analysis of the mouse cDNA.",
            "journal": "Biochem. J.",
            "date": "1996",
            "authors": "Kurita K, Shinomura T, Ujita M, Zako M, Kida D, Iwata H, Kimata K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8836137",
                    "url": "https://glygen.org/publication/PubMed/8836137"
                }
            ]
        },
        {
            "title": "The gene structure and organization of mouse PG-Lb, a small chondroitin/dermatan sulphate proteoglycan.",
            "journal": "Biochem. J.",
            "date": "1998",
            "authors": "Iwata Y, Shinomura T, Kurita K, Zako M, Kimata K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9560328",
                    "url": "https://glygen.org/publication/PubMed/9560328"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:13516",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13516",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "G3V6L6-1",
            "protein_name": "Epiphycan",
            "gene_name": "Epyc",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MKHTRIHIHWSEVNTKDSVCSVTLCHFVKSEPKKSQKMRMAARIVLVLIIIDATLAAPTTELFNYDSEVYDAILEDTGTFYNYEHIPDNQVETEKVAERLSGNRELLTPGPQLGDSQDEDKDEESTPRLIDGSSPQEPEFPGLLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKKTTYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRNLPRLQELVLRDNKIKQLPELPNTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYITDNSLDHIPLPLPENLQALHLQNNDILEMHEDTFCNVKNLTYVRKALEDIRLDGNPINLSKTPQAYMCLPRLPIGSFI",
                "length": 359
            },
            "evidence": [
                {
                    "id": "45228193",
                    "url": "http://www.informatics.jax.org/homology/45228193",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q99645-1",
            "protein_name": "Epiphycan",
            "gene_name": "EPYC",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV",
                "length": 322
            },
            "evidence": [
                {
                    "id": "45228193",
                    "url": "http://www.informatics.jax.org/homology/45228193",
                    "database": "MGI"
                },
                {
                    "id": "P70186",
                    "url": "https://omabrowser.org/oma/group/P70186/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70186",
                                "url": "https://www.uniprot.org/uniprot/P70186"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular matrix",
                        "id": "GO:0031012",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70186",
                                "url": "https://www.uniprot.org/uniprot/P70186"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "sensory perception of sound",
                        "id": "GO:0007605",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007605",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70186",
                                "url": "https://www.uniprot.org/uniprot/P70186"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "bone development",
                        "id": "GO:0060348",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060348",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70186",
                                "url": "https://www.uniprot.org/uniprot/P70186"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "articular cartilage development",
                        "id": "GO:0061975",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061975",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P70186",
                                "url": "https://www.uniprot.org/uniprot/P70186"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 283,
            "end_pos": 285,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 302,
            "end_pos": 304,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "The O-linked polysaccharide on Ser-96 is probably the mucin type linked to GalNAc. There is one glycosaminoglycan chain, known to be dermatan sulfate, and it is probably the O-glycosylation at Ser-64.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P70186",
                    "url": "https://www.uniprot.org/uniprot/P70186"
                },
                {
                    "database": "PubMed",
                    "id": "P79119",
                    "url": "https://glygen.org/publication/PubMed/P79119"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 4
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 4
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}