{ "uniprot_canonical_ac": "P63277-4", "uniprot_ac": "P63277", "uniprot_id": "AMELX_MOUSE", "mass": { "chemical_mass": 23483.0, "monoisotopic_mass": 23483.0 }, "refseq": { "ac": "NP_001075447", "name": "amelogenin, X isoform isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447" }, "gene_names": [ { "name": "Amelx", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P63277", "id": "P63277" }, { "name": "ALGN; Amel; Amg; AMGL; AMGX; LRAP; Rgsc888", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447", "id": "NP_001075447" }, { "name": "Amelx", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447", "id": "NP_001075447" }, { "name": "Amel", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P63277", "id": "P63277" } ], "protein_names": [ { "name": "Amelogenin, X isoform", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P63277" }, { "name": "LRAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P63277" }, { "name": "Leucine-rich amelogenin peptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P63277" }, { "name": "amelogenin, X isoform isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447", "id": "NP_001075447" }, { "name": "enamel matrix protein; leucine-rich amelogenin peptide; amelogenin X chromosome", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447", "id": "NP_001075447" } ], "function": [ { "annotation": "High-yield recombinant bacterial expression of [13] C-, [15] N-labeled, serine-16 phosphorylated, murine amelogenin using a modified third generation genetic code expansion protocol.", "evidence": [ { "database": "RefSeq", "id": "NP_001075447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447" }, { "database": "PubMed", "id": "36585836", "url": "https://glygen.org/publication/PubMed/36585836" } ] }, { "annotation": "Plays a role in the biomineralization of teeth. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277#function" } ] } ], "disease": [ { "disease_id": "DOID:0090109", "recommended_name": { "id": "DOID:0090109", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090109", "name": "autosomal dominant hypocalcemia", "description": "A metal metabolism disorder characterized by autosomal dominant inheritance of variable degrees of hypocalcemia with normal to low levels of parathyroid hormone." }, "synonyms": [ { "id": "DOID:0090109", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090109", "name": "HYPOC", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "autosomal dominant hypocalcemia 1", "description": "Any autosomal dominant hypocalcemia in which the cause of the disease is a mutation in the CASR gene." }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, autosomal dominant", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "CASR autosomal dominant hypocalcemia", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "HYPOC1", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "autosomal dominant hypocalcemia caused by mutation in CASR", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "autosomal dominant hypocalcemia type 1", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, autosomal dominant type 1", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, autosomal dominant, with Bartter syndrome", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypercalciuric hypocalcemia", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, autosomal dominant 1", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, autosomal dominant 1, with Bartter syndrome", "description": "" }, { "id": "MONDO:0011013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011013", "name": "hypocalcemia, familial", "description": "" }, { "id": "MIM:601198", "resource": "MIM", "url": "https://www.omim.org/entry/601198", "name": "Hypocalcemia, autosomal dominant 1", "description": "Hypocalcemia, autosomal dominant 1" } ], "evidence": [ { "id": "0090109", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0090109" } ] }, { "disease_id": "DOID:0110058", "recommended_name": { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "amelogenesis imperfecta type 1E", "description": "An amelogenesis imperfecta that has_material_basis_in X-linked dominant mutation in the gene encoding amelogenin (AMELX)." }, "synonyms": [ { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "AIH1", "description": "" }, { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "X-linked amelogenesis imperfecta 1", "description": "" }, { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "amelogenesis imperfecta type IE", "description": "" }, { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "X-linked amelogenesis imperfecta hypoplastic/hypomaturation 1", "description": "" }, { "id": "DOID:0110058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110058", "name": "amelogenesis imperfecta hypomaturationtype with snow-capped teeth", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta type 1E", "description": "Any amelogenesis imperfecta in which the cause of the disease is a mutation in the AMELX gene." }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "AIH1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "AMELX amelogenesis imperfecta", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "X-linked amelogenesis imperfecta 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "X-linked amelogenesis imperfecta hypoplastic/hypomaturation 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta caused by mutation in AMELX", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta hypomaturationtype with snow-capped teeth", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta type IE", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, type 1E, X-linked dominant", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "AI1E", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "X-linked enamel hypoplasia", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta X-linked 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta hypoplastic/hypomaturation X-linked 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, X-linked 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, hypomaturation type, with Snow-capped teeth", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, hypoplastic/hypomaturation, X-linked 1", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, type 1E", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "amelogenesis imperfecta, type IE", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "enamel hypoplasia X-linked", "description": "" }, { "id": "MONDO:0010521", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010521", "name": "enamel hypoplasia, X-linked", "description": "" }, { "id": "MIM:301200", "resource": "MIM", "url": "https://www.omim.org/entry/301200", "name": "Amelogenesis imperfecta 1E", "description": "Amelogenesis imperfecta 1E" } ], "evidence": [ { "id": "0110058", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110058" } ] }, { "disease_id": "DOID:2187", "recommended_name": { "id": "DOID:2187", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2187", "name": "amelogenesis imperfecta", "description": "A dental enamel hypoplasia characterized by abnormal enamel formation." }, "synonyms": [ { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta type 1B", "description": "Any amelogenesis imperfecta in which the cause of the disease is a mutation in the ENAM gene." }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "AI1B", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "ENAM amelogenesis imperfecta", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta caused by mutation in ENAM", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta caused by mutation in enam", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta type IB", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "autosomal dominant hypoplastic local amelogenesis imperfecta", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "enam amelogenesis imperfecta", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "hereditary localised enamel hypoplasia", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "hereditary localized enamel hypoplasia", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "AIH2", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta, hypoplastic local, autosomal dominant", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta, type 1B", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "amelogenesis imperfecta, type IB", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "enamel hypoplasia, hereditary localised", "description": "" }, { "id": "MONDO:0007092", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007092", "name": "enamel hypoplasia, hereditary localized", "description": "" }, { "id": "MIM:104500", "resource": "MIM", "url": "https://www.omim.org/entry/104500", "name": "Amelogenesis imperfecta 1B", "description": "Amelogenesis imperfecta 1B" } ], "evidence": [ { "id": "2187", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2187" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Amelx", "url": "https://www.uniprot.org/uniprot/P63277", "locus": { "chromosome": "X", "start_pos": 167959110, "end_pos": 167970196, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000031354", "url": "https://www.ensembl.org/id/ENSMUSG00000031354" } ] } } ], "crossref": [ { "id": "ENSMUSG00000031354", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031354", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "11704", "url": "https://www.ncbi.nlm.nih.gov/gene/11704", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:11704", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11704", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "88005", "url": "http://www.informatics.jax.org/marker/MGI:88005", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4520512at2759", "url": "http://www.orthodb.org/?query=4520512at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46794", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46794", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46794:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46794:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02948", "url": "http://pfam.xfam.org/family/PF02948", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P63277", "url": "http://purl.obolibrary.org/obo/PR_P63277", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001075447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P63277-1", "url": "https://www.uniprot.org/uniprot/P63277-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P63277-2", "url": "https://www.uniprot.org/uniprot/P63277-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P63277-3", "url": "https://www.uniprot.org/uniprot/P63277-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P63277-4", "url": "https://www.uniprot.org/uniprot/P63277-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD", "length": 210, "header": "sp|P63277-4|AMELX_MOUSE Isoform 4 of Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1 CANONICAL=P63277-4" }, "isoforms": [ { "isoform_ac": "P63277-1", "url": "", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD", "length": 196, "header": "sp|P63277-1|AMELX_MOUSE Isoform 1 of Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1 CANONICAL=P63277-4" }, "locus": { "chromosome": "X", "start_pos": 167968860, "end_pos": 167963170, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112118", "url": "https://www.ensembl.org/id/ENSMUST00000112118" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107746", "url": "https://www.ensembl.org/id/ENSMUSP00000107746" } ] } }, { "isoform_ac": "P63277-2", "url": "", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEVLTPLKWYQSMIRQPPLSPILPELPLEAWPATDKTKREEVD", "length": 75, "header": "sp|P63277-2|AMELX_MOUSE Isoform 2 of Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1 CANONICAL=P63277-4" }, "locus": {} }, { "isoform_ac": "P63277-3", "url": "", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEVLTPLKWYQSMIRQPHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD", "length": 172, "header": "sp|P63277-3|AMELX_MOUSE Isoform 3 of Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1 CANONICAL=P63277-4" }, "locus": { "chromosome": "X", "start_pos": 167968860, "end_pos": 167963170, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112120", "url": "https://www.ensembl.org/id/ENSMUST00000112120" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107748", "url": "https://www.ensembl.org/id/ENSMUSP00000107748" } ] } }, { "isoform_ac": "P63277-4", "url": "", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD", "length": 210, "header": "sp|P63277-4|AMELX_MOUSE Isoform 4 of Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1 CANONICAL=P63277-4" }, "locus": { "chromosome": "X", "start_pos": 167968860, "end_pos": 167963170, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112119", "url": "https://www.ensembl.org/id/ENSMUST00000112119" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107747", "url": "https://www.ensembl.org/id/ENSMUSP00000107747" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "site_lbl": "Ser32" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Amelogenin interacts with cytokeratin-5 in ameloblasts during enamel growth.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Ravindranath RM, Basilrose RM Sr, Ravindranath NH, Vaitheesvaran B", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "reference": [ { "type": "PubMed", "id": "12657653", "url": "https://glygen.org/publication/PubMed/12657653" } ] }, { "title": "Alternative splicing of the mouse amelogenin primary RNA transcript contributes to amelogenin heterogeneity.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1992", "authors": "Zeichner-David M., Fincham A.G., Simmer J.P., Slavkin H.C., Snead M.L., Bringas P. Jr., Hsu D.D.J., Hu C.C., Lau E.C., Thiemann F.", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "reference": [ { "type": "PubMed", "id": "1445358", "url": "https://glygen.org/publication/PubMed/1445358" } ] }, { "title": "High-yield recombinant bacterial expression of 13 C-, 15 N-labelled, serine-16 phosphorylated, murine amelogenin using a modified third generation genetic code expansion protocol.", "journal": "Protein science : a publication of the Protein Society", "date": "2022-12-31", "authors": "Buchko Garry W, Zhou Mowei, Vesely Cat Hoang, Tao Jinhui, Shaw Wendy J, Mehl Ryan A, Cooley Richard B", "evidence": [ { "database": "RefSeq", "id": "NP_001075447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001075447" } ], "reference": [ { "type": "PubMed", "id": "36585836", "url": "https://glygen.org/publication/PubMed/36585836" } ] }, { "title": "DNA sequence for cloned cDNA for murine amelogenin reveal the amino acid sequence for enamel-specific protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1985", "authors": "Zeichner-David M., Fincham A.G., Slavkin H.C., Snead M.L., Lau E.C., Woo S.L.", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "reference": [ { "type": "PubMed", "id": "4015654", "url": "https://glygen.org/publication/PubMed/4015654" } ] }, { "title": "Molecular structure of the mouse amelogenin genomic DNA.", "journal": "DNA Seq.", "date": "1996", "authors": "Sasaki M., Suzuki M., Shimokawa H., Iimura T., Oida S., Miyazaki H.", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "reference": [ { "type": "PubMed", "id": "8988368", "url": "https://glygen.org/publication/PubMed/8988368" } ] } ], "pathway": [ { "id": "mmu:11704", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11704", "resource": "KEGG Pathway" }, { "id": "R-MMU-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-MMU-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" } ], "orthologs": [ { "uniprot_canonical_ac": "P63278-4", "protein_name": "Amelogenin, X isoform", "gene_name": "Amelx", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD", "length": 210 }, "evidence": [ { "id": "45240340", "url": "http://www.informatics.jax.org/homology/45240340", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99217-1", "protein_name": "Amelogenin, X isoform", "gene_name": "AMELX", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD", "length": 191 }, "evidence": [ { "id": "45240340", "url": "http://www.informatics.jax.org/homology/45240340", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q99218-2", "protein_name": "Amelogenin, Y isoform", "gene_name": "AMELY", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD", "length": 206 }, "evidence": [ { "id": "45240340", "url": "http://www.informatics.jax.org/homology/45240340", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "supramolecular complex", "id": "GO:0099080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099080", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "tooth mineralization", "id": "GO:0034505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034505", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "enamel mineralization", "id": "GO:0070166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070166", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "amelogenesis", "id": "GO:0097186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097186", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "structural constituent of tooth enamel", "id": "GO:0030345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030345", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "hydroxyapatite binding", "id": "GO:0046848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046848", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" }, { "name": "sodium ion binding", "id": "GO:0031402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031402", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 30, "end_pos": 32, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by FAM20C in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P63277", "url": "https://www.uniprot.org/uniprot/P63277" }, { "database": "PubMed", "id": "Q99217", "url": "https://glygen.org/publication/PubMed/Q99217" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }