{
    "uniprot_canonical_ac": "P63250-1",
    "uniprot_ac": "P63250",
    "uniprot_id": "KCNJ3_MOUSE",
    "mass": {
        "chemical_mass": 56573.0,
        "monoisotopic_mass": 56573.0
    },
    "refseq": {
        "ac": "NP_032452",
        "name": "G protein-activated inward rectifier potassium channel 1 isoform 1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452"
    },
    "gene_names": [
        {
            "name": "Kcnj3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P63250",
            "id": "P63250"
        },
        {
            "name": "GIRK-1; GIRK1; Kcnf3; Kcnj1; Kir3.1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452",
            "id": "NP_032452"
        },
        {
            "name": "Girk1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P63250",
            "id": "P63250"
        },
        {
            "name": "Kcnj3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452",
            "id": "NP_032452"
        }
    ],
    "protein_names": [
        {
            "name": "G protein-activated inward rectifier potassium channel 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P63250"
        },
        {
            "name": "G protein-activated inward rectifier potassium channel 1 isoform 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452",
            "id": "NP_032452"
        },
        {
            "name": "G protein-activated inward rectifier potassium channel 1 isoform 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739",
            "id": "NP_001291739"
        },
        {
            "name": "GIRK-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P63250"
        },
        {
            "name": "Inward rectifier K(+) channel Kir3.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P63250"
        },
        {
            "name": "Potassium channel, inwardly rectifying subfamily J member 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P63250"
        },
        {
            "name": "g protein-activated inward rectifier potassium channel 1; inward rectifier K(+) channel Kir3.1; potassium channel, inwardly rectifying subfamily J member 3; G protein-gated K+ channel subunit 1 GIRK1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739",
            "id": "NP_001291739"
        }
    ],
    "function": [
        {
            "annotation": "G-Protein-Gated Inwardly Rectifying Potassium (Kir3/GIRK) Channels Govern Synaptic Plasticity That Supports Hippocampal-Dependent Cognitive Functions in Male Mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001291739",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739"
                },
                {
                    "database": "PubMed",
                    "id": "34261700",
                    "url": "https://glygen.org/publication/PubMed/34261700"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_032452",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452"
                }
            ]
        },
        {
            "annotation": "Suppression of pyramidal neuron G protein-gated inwardly rectifying K+ channel signaling impairs prelimbic cortical function and underlies stress-induced deficits in cognitive flexibility in male, but not female, mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001291739",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739"
                },
                {
                    "database": "PubMed",
                    "id": "34158613",
                    "url": "https://glygen.org/publication/PubMed/34158613"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_032452",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452"
                }
            ]
        },
        {
            "annotation": "This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Kcnj3",
            "url": "https://www.uniprot.org/uniprot/P63250",
            "locus": {
                "chromosome": "2",
                "start_pos": 55488157,
                "end_pos": 55325982,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000026824",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000026824"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000026824",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026824",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "16519",
            "url": "https://www.ncbi.nlm.nih.gov/gene/16519",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR003274",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003274",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013518",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013518",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR014756",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR016449",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016449",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR040445",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR040445",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR041647",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR041647",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:16519",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16519",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "104742",
            "url": "http://www.informatics.jax.org/marker/MGI:104742",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P63250",
            "url": "https://oglcnac.org/atlas/detail/P63250",
            "database": "O-GlcNAc Atlas",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "P63250",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63250",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "PARMEGN",
            "url": "https://omabrowser.org/oma/group/PARMEGN/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4126787at2759",
            "url": "http://www.orthodb.org/?query=4126787at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11767",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11767",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11767:SF16",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11767:SF16",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1N9P",
            "url": "https://www.rcsb.org/structure/1N9P",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1U4E",
            "url": "https://www.rcsb.org/structure/1U4E",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2QKS",
            "url": "https://www.rcsb.org/structure/2QKS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3K6N",
            "url": "https://www.rcsb.org/structure/3K6N",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5UM4",
            "url": "https://www.rcsb.org/structure/5UM4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF01007",
            "url": "http://pfam.xfam.org/family/PF01007",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF17655",
            "url": "http://pfam.xfam.org/family/PF17655",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P63250",
            "url": "http://purl.obolibrary.org/obo/PR_P63250",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-1296041",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1296041",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-997272",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-997272",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_032452",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B1AYE4",
            "url": "https://www.uniprot.org/uniprot/B1AYE4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B1AYE4-1",
            "url": "https://www.uniprot.org/uniprot/B1AYE4-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P63250",
            "url": "https://www.uniprot.org/uniprot/P63250",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P63250-1",
            "url": "https://www.uniprot.org/uniprot/P63250-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT",
        "length": 501,
        "header": "sp|P63250-1|KCNJ3_MOUSE Isoform 1 of G protein-activated inward rectifier potassium channel 1  OS=Mus musculus OX=10090 GN=Kcnj3 PE=1 SV=1 CANONICAL=P63250-1"
    },
    "isoforms": [
        {
            "isoform_ac": "B1AYE4-1",
            "url": "",
            "sequence": {
                "sequence": "MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKE",
                "length": 235,
                "header": "tr|B1AYE4-1|B1AYE4_MOUSE Computationally mapped isoform of Potassium inwardly-rectifying channel, subfamily J, member 3  OS=Mus musculus OX=10090 GN=Kcnj3 PE=1 SV=1 CANONICAL=P63250-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 55484825,
                "end_pos": 55327213,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000112632.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000112632.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000108251.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000108251.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P63250-1",
            "url": "",
            "sequence": {
                "sequence": "MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT",
                "length": 501,
                "header": "sp|P63250-1|KCNJ3_MOUSE Isoform 1 of G protein-activated inward rectifier potassium channel 1  OS=Mus musculus OX=10090 GN=Kcnj3 PE=1 SV=1 CANONICAL=P63250-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 55485406,
                "end_pos": 55327213,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000112633",
                        "url": "https://www.ensembl.org/id/ENSMUST00000112633"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000108252",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000108252"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 119,
            "start_aa": "Asn",
            "end_pos": 119,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn119",
            "evidence": [
                {
                    "id": "P63250",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P63250#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "T",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "start_pos": 17,
            "start_aa": "Thr",
            "end_pos": 17,
            "end_aa": "Thr",
            "residue": "Thr",
            "site_lbl": "Thr17",
            "evidence": [
                {
                    "id": "P63250",
                    "database": "O-GlcNAc Atlas",
                    "url": "https://oglcnac.org/atlas/detail/P63250"
                },
                {
                    "id": "34678516",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/34678516"
                }
            ]
        },
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "P63250",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63250"
                },
                {
                    "id": "34678516",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/34678516"
                },
                {
                    "id": "22517741",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/22517741"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 385,
            "end_pos": 385,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                },
                {
                    "database": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                },
                {
                    "database": "iPTMnet",
                    "id": "P63250",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P63250"
                }
            ],
            "site_lbl": "Ser385"
        },
        {
            "start_pos": 424,
            "end_pos": 424,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                },
                {
                    "database": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                },
                {
                    "database": "iPTMnet",
                    "id": "P63250",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P63250"
                }
            ],
            "site_lbl": "Ser424"
        }
    ],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "Structural basis of inward rectification: cytoplasmic pore of the G protein-gated inward rectifier GIRK1 at 1.8 A resolution.",
            "journal": "Cell",
            "date": "2002",
            "authors": "Nishida M., MacKinnon R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12507423",
                    "url": "https://glygen.org/publication/PubMed/12507423"
                }
            ]
        },
        {
            "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.",
            "journal": "Cell",
            "date": "2010",
            "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                },
                {
                    "database": "iPTMnet",
                    "id": "P63250",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P63250"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                }
            ]
        },
        {
            "title": "Tandem mass spectrometry identifies many mouse brain O-GlcNAcylated proteins including EGF domain-specific O-GlcNAc transferase targets.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2012",
            "authors": "Alfaro JF, Gong CX, Monroe ME, Aldrich JT, Clauss TR, Purvine SO, Wang Z, Camp DG 2nd, Shabanowitz J, Stanley P, Hart GW, Hunt DF, Yang F, Smith RD",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "P63250",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63250"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22517741",
                    "url": "https://glygen.org/publication/PubMed/22517741"
                }
            ]
        },
        {
            "title": "Suppression of pyramidal neuron G protein-gated inwardly rectifying K+ channel signaling impairs prelimbic cortical function and underlies stress-induced deficits in cognitive flexibility in male, but not female, mice.",
            "journal": "Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology",
            "date": "2021",
            "authors": "Anderson EM, Loke S, Wrucke B, Engelhardt A, Demis S, O'Reilly K, Hess E, Wickman K, Hearing MC",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001291739",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_032452",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34158613",
                    "url": "https://glygen.org/publication/PubMed/34158613"
                }
            ]
        },
        {
            "title": "G-Protein-Gated Inwardly Rectifying Potassium (Kir3/GIRK) Channels Govern Synaptic Plasticity That Supports Hippocampal-Dependent Cognitive Functions in Male Mice.",
            "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
            "date": "2021",
            "authors": "Djebari S, Iborra-Lazaro G, Temprano-Carazo S, Sanchez-Rodriguez I, Nava-Mesa MO, Munera A, Gruart A, Delgado-Garcia JM, Jimenez-Diaz L, Navarro-Lopez JD",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_032452",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032452"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001291739",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001291739"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34261700",
                    "url": "https://glygen.org/publication/PubMed/34261700"
                }
            ]
        },
        {
            "title": "Novel Antibodies for the Simple and Efficient Enrichment of Native O-GlcNAc Modified Peptides.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2021",
            "authors": "Burt RA, Dejanovic B, Peckham HJ, Lee KA, Li X, Ounadjela JR, Rao A, Malaker SA, Carr SA, Myers SA",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "P63250",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63250"
                },
                {
                    "database": "O-GlcNAc Atlas",
                    "id": "P63250",
                    "url": "https://oglcnac.org/atlas/detail/P63250"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34678516",
                    "url": "https://glygen.org/publication/PubMed/34678516"
                }
            ]
        },
        {
            "title": "Molecular cloning of a mouse G-protein-activated K+ channel (mGIRK1) and distinct distributions of three GIRK (GIRK1, 2 and 3) mRNAs in mouse brain.",
            "journal": "Biochem. Biophys. Res. Commun.",
            "date": "1995",
            "authors": "Kobayashi T, Ikeda K, Ichikawa T, Abe S, Togashi S, Kumanishi T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P63250",
                    "url": "https://www.uniprot.org/uniprot/P63250"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7702616",
                    "url": "https://glygen.org/publication/PubMed/7702616"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:16519",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16519",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-1296041",
            "name": "Activation of G protein gated Potassium channels",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1296041",
            "resource": "Reactome",
            "description": "Activation of G protein gated Potassium channels"
        },
        {
            "id": "R-MMU-997272",
            "name": "Inhibition  of voltage gated Ca2+ channels via Gbeta/gamma subunits",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-997272",
            "resource": "Reactome",
            "description": "Inhibition  of voltage gated Ca2+ channels via Gbeta/gamma subunits"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P48549-1",
            "protein_name": "G protein-activated inward rectifier potassium channel 1",
            "gene_name": "KCNJ3",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNLPAKLRKMNSDRFT",
                "length": 501
            },
            "evidence": [
                {
                    "id": "45228823",
                    "url": "http://www.informatics.jax.org/homology/45228823",
                    "database": "MGI"
                },
                {
                    "id": "P63250",
                    "url": "https://omabrowser.org/oma/group/P63250/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P63251-1",
            "protein_name": "G protein-activated inward rectifier potassium channel 1",
            "gene_name": "Kcnj3",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT",
                "length": 501
            },
            "evidence": [
                {
                    "id": "45228823",
                    "url": "http://www.informatics.jax.org/homology/45228823",
                    "database": "MGI"
                },
                {
                    "id": "P63250",
                    "url": "https://omabrowser.org/oma/group/P63250/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G-protein activated inward rectifier potassium channel activity",
                        "id": "GO:0015467",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015467",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "inward rectifier potassium channel activity",
                        "id": "GO:0005242",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005242",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential",
                        "id": "GO:0099508",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099508",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 8,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell surface",
                        "id": "GO:0009986",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "external side of plasma membrane",
                        "id": "GO:0009897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "voltage-gated potassium channel complex",
                        "id": "GO:0008076",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008076",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "T-tubule",
                        "id": "GO:0030315",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030315",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "presynaptic membrane",
                        "id": "GO:0042734",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042734",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "parallel fiber to Purkinje cell synapse",
                        "id": "GO:0098688",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098688",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "response to electrical stimulus",
                        "id": "GO:0051602",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051602",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of monoatomic ion transmembrane transport",
                        "id": "GO:0034765",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034765",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "potassium ion import across plasma membrane",
                        "id": "GO:1990573",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990573",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P63250",
                                "url": "https://www.uniprot.org/uniprot/P63250"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 119,
            "end_pos": 121,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}