{ "uniprot_canonical_ac": "P62951-1", "uniprot_ac": "P62951", "uniprot_id": "BLCAP_MOUSE", "mass": { "chemical_mass": 9876.0, "monoisotopic_mass": 9876.0 }, "refseq": { "ac": "NP_058612", "name": "bladder cancer-associated protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612" }, "gene_names": [ { "name": "Blcap", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P62951", "id": "P62951" }, { "name": "Bc10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612", "id": "NP_058612" }, { "name": "Bc10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62951", "id": "P62951" }, { "name": "Blcap", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612", "id": "NP_058612" } ], "protein_names": [ { "name": "Bladder cancer-associated protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P62951" }, { "name": "Bc10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62951" }, { "name": "Bladder cancer 10 kDa protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62951" }, { "name": "bladder cancer related protein; Blcapbladder cancer associated protein homolog; bladder cancer 10 kDa protein; bladder cancer associated protein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612", "id": "NP_058612" }, { "name": "bladder cancer-associated protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612", "id": "NP_058612" } ], "function": [ { "annotation": "Blcap is imprinted in mouse and human brain, but not in other mouse tissues.", "evidence": [ { "database": "RefSeq", "id": "NP_058612", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612" }, { "database": "PubMed", "id": "18836209", "url": "https://glygen.org/publication/PubMed/18836209" } ] }, { "annotation": "May regulate cell proliferation and coordinate apoptosis and cell cycle progression via a novel mechanism independent of both p53/TP53 and NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Blcap", "url": "https://www.uniprot.org/uniprot/P62951", "locus": { "chromosome": "2", "start_pos": 157398282, "end_pos": 157413194, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000067787", "url": "https://www.ensembl.org/id/ENSMUSG00000067787" } ] } } ], "crossref": [ { "id": "ENSMUSG00000067787", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000067787", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "53619", "url": "https://www.ncbi.nlm.nih.gov/gene/53619", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:53619", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:53619", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1858907", "url": "http://www.informatics.jax.org/marker/MGI:1858907", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FLLCYSC", "url": "https://omabrowser.org/oma/group/FLLCYSC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2871594at2759", "url": "http://www.orthodb.org/?query=2871594at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13259", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13259", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13259:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13259:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06726", "url": "http://pfam.xfam.org/family/PF06726", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P62951", "url": "http://purl.obolibrary.org/obo/PR_P62951", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_058612", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "G3UWQ6", "url": "https://www.uniprot.org/uniprot/G3UWQ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3UWQ6-1", "url": "https://www.uniprot.org/uniprot/G3UWQ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62951-1", "url": "https://www.uniprot.org/uniprot/P62951-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT", "length": 87, "header": "sp|P62951-1|BLCAP_MOUSE Isoform 1 of Bladder cancer-associated protein OS=Mus musculus OX=10090 GN=Blcap PE=3 SV=1 CANONICAL=P62951-1" }, "isoforms": [ { "isoform_ac": "G3UWQ6-1", "url": "", "sequence": { "sequence": "MYCLQWLLPVLLIPKPL", "length": 17, "header": "tr|G3UWQ6-1|G3UWQ6_MOUSE Computationally mapped isoform of Bladder cancer associated protein OS=Mus musculus OX=10090 GN=Blcap PE=4 SV=1 CANONICAL=P62951-1" }, "locus": { "chromosome": "2", "start_pos": 157400073, "end_pos": 157400023, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000173378.8", "url": "https://www.ensembl.org/id/ENSMUST00000173378.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000133386.2", "url": "https://www.ensembl.org/id/ENSMUSP00000133386.2" } ] } }, { "isoform_ac": "P62951-1", "url": "", "sequence": { "sequence": "MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT", "length": 87, "header": "sp|P62951-1|BLCAP_MOUSE Isoform 1 of Bladder cancer-associated protein OS=Mus musculus OX=10090 GN=Blcap PE=3 SV=1 CANONICAL=P62951-1" }, "locus": { "chromosome": "2", "start_pos": 157400073, "end_pos": 157399813, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000088494", "url": "https://www.ensembl.org/id/ENSMUST00000088494" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000085849", "url": "https://www.ensembl.org/id/ENSMUSP00000085849" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Transcript- and tissue-specific imprinting of a tumour suppressor gene.", "journal": "Human molecular genetics", "date": "2009", "authors": "Schulz R, McCole RB, Woodfine K, Wood AJ, Chahal M, Monk D, Moore GE, Oakey RJ", "evidence": [ { "database": "RefSeq", "id": "NP_058612", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058612" } ], "reference": [ { "type": "PubMed", "id": "18836209", "url": "https://glygen.org/publication/PubMed/18836209" } ] } ], "pathway": [ { "id": "mmu:53619", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:53619", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P62950-1", "protein_name": "Bladder cancer-associated protein", "gene_name": "Blcap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT", "length": 87 }, "evidence": [ { "id": "45225067", "url": "http://www.informatics.jax.org/homology/45225067", "database": "MGI" }, { "id": "P62951", "url": "https://omabrowser.org/oma/group/P62951/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P62952-1", "protein_name": "Bladder cancer-associated protein", "gene_name": "BLCAP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT", "length": 87 }, "evidence": [ { "id": "45225067", "url": "http://www.informatics.jax.org/homology/45225067", "database": "MGI" }, { "id": "P62951", "url": "https://omabrowser.org/oma/group/P62951/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951" } ], "pmid": "" }, { "name": "apoptotic nuclear changes", "id": "GO:0030262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030262", "evidence": [ { "database": "UniProtKB", "id": "P62951", "url": "https://www.uniprot.org/uniprot/P62951" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }