{ "uniprot_canonical_ac": "P62839-1", "uniprot_ac": "P62839", "uniprot_id": "UB2D2_RAT", "mass": { "chemical_mass": 16735.0, "monoisotopic_mass": 16735.0 }, "refseq": {}, "gene_names": [ { "name": "Ube2d2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P62839", "id": "P62839" }, { "name": "Ubc4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62839", "id": "P62839" }, { "name": "Ubch4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62839", "id": "P62839" }, { "name": "Ubch5b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62839", "id": "P62839" } ], "protein_names": [ { "name": "Ubiquitin-conjugating enzyme E2 D2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P62839" }, { "name": "(E3-independent) E2 ubiquitin-conjugating enzyme D2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "2.3.2.23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "2.3.2.24", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "E2 ubiquitin-conjugating enzyme D2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "Ubiquitin carrier protein D2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "Ubiquitin-conjugating enzyme E2(17)KB 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "Ubiquitin-conjugating enzyme E2-17 kDa 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" }, { "name": "Ubiquitin-protein ligase D2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62839" } ], "function": [ { "annotation": "Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by RIGI in response to viral infection. Essential for viral activation of IRF3 (By similarity). Mediates ubiquitination of PEX5.", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839#function" }, { "database": "PubMed", "id": "18359941", "url": "https://glygen.org/publication/PubMed/18359941" }, { "database": "UniProtKB", "id": "P62837", "url": "https://www.uniprot.org/uniprot/P62837#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ube2d2", "url": "https://www.uniprot.org/uniprot/P62839", "locus": { "chromosome": "18", "start_pos": 27406181, "end_pos": 27364303, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000069286", "url": "https://www.ensembl.org/id/ENSRNOG00000069286" } ] } } ], "crossref": [ { "id": "cd00195", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00195", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "641452", "url": "https://www.ncbi.nlm.nih.gov/gene/641452", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:641452", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:641452", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VHFTTRI", "url": "https://omabrowser.org/oma/group/VHFTTRI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5478564at2759", "url": "http://www.orthodb.org/?query=5478564at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24068", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24068:SF330", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068:SF330", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00179", "url": "http://pfam.xfam.org/family/PF00179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P62839", "url": "http://purl.obolibrary.org/obo/PR_P62839", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234176", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357905", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8866652", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866652", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866654", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033241", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9705462", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001032369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032369", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1591897", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1591897", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62839-1", "url": "https://www.uniprot.org/uniprot/P62839-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM", "length": 147, "header": "sp|P62839-1|UB2D2_RAT Isoform 1 of Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus OX=10116 GN=Ube2d2 PE=1 SV=1 CANONICAL=P62839-1" }, "isoforms": [ { "isoform_ac": "P62839-1", "url": "", "sequence": { "sequence": "MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM", "length": 147, "header": "sp|P62839-1|UB2D2_RAT Isoform 1 of Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus OX=10116 GN=Ube2d2 PE=1 SV=1 CANONICAL=P62839-1" }, "locus": { "chromosome": "18", "start_pos": 27404714, "end_pos": 27364729, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095794", "url": "https://www.ensembl.org/id/ENSRNOT00000095794" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000088484", "url": "https://www.ensembl.org/id/ENSRNOP00000088484" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Grou CP, Carvalho AF, Pinto MP, Wiese S, Piechura H, Meyer HE, Warscheid B, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "reference": [ { "type": "PubMed", "id": "18359941", "url": "https://glygen.org/publication/PubMed/18359941" } ] }, { "title": "Molecular cloning, expression and characterization of a ubiquitin conjugation enzyme (E2(17)kB) highly expressed in rat testis.", "journal": "Biochem. J.", "date": "1995", "authors": "Wing SS, Jain P", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "reference": [ { "type": "PubMed", "id": "7826319", "url": "https://glygen.org/publication/PubMed/7826319" } ] } ], "pathway": [ { "id": "rno:641452", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:641452", "resource": "KEGG Pathway" }, { "id": "R-RNO-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234176", "resource": "Reactome", "description": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "id": "R-RNO-5357905", "name": "Regulation of TNFR1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357905", "resource": "Reactome", "description": "Regulation of TNFR1 signaling" }, { "id": "R-RNO-8866652", "name": "Synthesis of active ubiquitin: roles of E1 and E2 enzymes", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866652", "resource": "Reactome", "description": "Synthesis of active ubiquitin: roles of E1 and E2 enzymes" }, { "id": "R-RNO-8866654", "name": "E3 ubiquitin ligases ubiquitinate target proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866654", "resource": "Reactome", "description": "E3 ubiquitin ligases ubiquitinate target proteins" }, { "id": "R-RNO-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-RNO-9033241", "name": "Peroxisomal protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033241", "resource": "Reactome", "description": "Peroxisomal protein import" }, { "id": "R-RNO-9705462", "name": "Inactivation of CSF3 (G-CSF) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9705462", "resource": "Reactome", "description": "Inactivation of CSF3 (G-CSF) signaling" }, { "id": "R-RNO-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "P15731-1", "protein_name": "Ubiquitin-conjugating enzyme E2 4", "gene_name": "UBC4", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV", "length": 148 }, "evidence": [ { "id": "P62839", "url": "https://omabrowser.org/oma/group/P62839/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM", "length": 147 }, "evidence": [ { "id": "45235088", "url": "http://www.informatics.jax.org/homology/45235088", "database": "MGI" }, { "id": "P62839", "url": "https://omabrowser.org/oma/group/P62839/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P62838-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "Ube2d2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM", "length": 147 }, "evidence": [ { "id": "45235088", "url": "http://www.informatics.jax.org/homology/45235088", "database": "MGI" }, { "id": "P62839", "url": "https://omabrowser.org/oma/group/P62839/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin conjugating enzyme activity", "id": "GO:0061631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061631", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "protein polyubiquitination", "id": "GO:0000209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" }, { "name": "protein K48-linked ubiquitination", "id": "GO:0070936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070936", "evidence": [ { "database": "UniProtKB", "id": "P62839", "url": "https://www.uniprot.org/uniprot/P62839" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-1234163", "name": "Cytosolic VBC complex ubiquitinylates hydroxyprolyl-HIF-alpha", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P59722-1", "Q62630-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-1234163", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234163" } ] }, { "id": "R-RNO-1234172", "name": "Nuclear VBC complex ubiquitinylates HIF-alpha", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-1234172", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234172" } ] }, { "id": "R-RNO-8852127", "name": "UBA6 conjugates ubiquitin to cytosolic E2 enzymes", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B5DFI8-1", "P62839-1", "D3ZDK2-1", "Q3B7D1-1", "D4A8H3-1" ], "evidence": [ { "id": "R-RNO-8852127", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8852127" } ] }, { "id": "R-RNO-8852129", "name": "UBA1 conjugates ubiquitin to cytosolic E2 enzymes", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B5DFI8-1", "P62839-1", "D3ZDK2-1", "P62255-1", "Q5U300-1" ], "evidence": [ { "id": "R-RNO-8852129", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8852129" } ] }, { "id": "R-RNO-8852130", "name": "UBA1 conjugates ubiquitin to nuclear E2 enzymes", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63149-1", "B5DFI8-1", "P62839-1", "Q5U300-1" ], "evidence": [ { "id": "R-RNO-8852130", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8852130" } ] }, { "id": "R-RNO-8939323", "name": "RNF181 binds BCL10 and Ubiquitin:E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P62839-1", "D3ZDK2-1", "Q6AXU4-1", "Q9EQX9-1" ], "evidence": [ { "id": "R-RNO-8939323", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939323" } ] }, { "id": "R-RNO-8939335", "name": "RNF181 polyubiquinates BCL10", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P62839-1", "D3ZDK2-1", "Q6AXU4-1", "Q9EQX9-1" ], "evidence": [ { "id": "R-RNO-8939335", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939335" } ] }, { "id": "R-RNO-8953917", "name": "PEX2:PEX10:PEX12 binds PEX5S,L (in PEX5S:PEX13:PEX14) and Ub:UBE2D1,2,3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P24392-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-8953917", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8953917" } ] }, { "id": "R-RNO-8953946", "name": "PEX2:PEX10:PEX12 monoubiquitinates PEX5S,L at cysteine-11", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P24392-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-8953946", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8953946" } ] }, { "id": "R-RNO-8956106", "name": "VHL:EloB,C:NEDD8-CUL2:RBX1 complex ubiquitinylates HIF-alpha", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-8956106", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8956106" } ] }, { "id": "R-RNO-9033485", "name": "PEX2:PEX10:PEX12 monoubiquitinates PEX5L at cysteine-11", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P24392-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-9033485", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033485" } ] }, { "id": "R-RNO-9033527", "name": "PEX2:PEX10:PEX12 binds PEX5L (in PEX5L:PEX7:PEX13:PEX14:PEX2:PEX10:PEX12) and Ub:UBE2D1,2,3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "P24392-1", "P62839-1", "D3ZDK2-1" ], "evidence": [ { "id": "R-RNO-9033527", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9033527" } ] }, { "id": "R-RNO-9705738", "name": "SOCS1,3 ubiquitinates CSF3R in SOCS1,3:p-4Y-CSF3R:CSF3 dimer:LYN:p-Y-JAK1:p-JAK2:p-SYK:p-HCK:p-TYK2:CUL5:ELOB:ELOC:RNF7", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endocytic vesicle membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61078-1", "Q07014-1", "Q64725-1", "P62839-1", "Q62689-1", "D3ZDK2-1", "P50545-1", "A0A8I6AM23-1", "D3ZD03-1" ], "evidence": [ { "id": "R-RNO-9705738", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9705738" } ] }, { "id": "R-RNO-9815507", "name": "MIB2 ubiquitinates CYLD at K338, K530", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66H62-1", "P62839-1", "D3ZDK2-1", "Q68LP1-1" ], "evidence": [ { "id": "R-RNO-9815507", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9815507" } ] }, { "id": "R-RNO-9815510", "name": "MIB2 binds CYLD", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66H62-1", "P62839-1", "Q68LP1-1" ], "evidence": [ { "id": "R-RNO-9815510", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9815510" } ] }, { "id": "R-RNO-983140", "name": "Transfer of Ub from E2 to substrate and release of E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983140", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983140" } ] }, { "id": "R-RNO-983152", "name": "Transfer of ubiquitin from E1 to E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63149-1", "P61078-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q99MI7-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q5U300-1", "Q9EQX9-1", "D4A8H3-1", "A0A0G2K735-1" ], "evidence": [ { "id": "R-RNO-983152", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983152" } ] }, { "id": "R-RNO-983156", "name": "Polyubiquitination of substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983156", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983156" } ] }, { "id": "R-RNO-983157", "name": "Interaction of E3 with substrate and E2-Ub complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983157" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JUC9", "gene_name": "Herc2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2JUC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUC9" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2JUC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUC9" } ] } ] }, { "uniprot_ac": "A0A0G2K0E7", "gene_name": "Ube3b", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K0E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K0E7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K0E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K0E7" } ] } ] }, { "uniprot_ac": "A0A0G2K612", "gene_name": "Smurf1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K612" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K612" } ] } ] }, { "uniprot_ac": "A0A0G2K6H9", "gene_name": "Rnf19b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "A0A0G2K6H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6H9" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "A0A0G2K6H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6H9" } ] } ] }, { "uniprot_ac": "A0A0G2K735", "gene_name": "Uba7", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "A0A0G2K735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K735" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "A0A0G2K735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K735" } ] } ] }, { "uniprot_ac": "A0A0G2K9T1", "gene_name": "Itch", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] } ] }, { "uniprot_ac": "A0A0G2QC40", "gene_name": "Mkrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2QC40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A0G2QC40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ] } ] }, { "uniprot_ac": "A0A8I5YBG5", "gene_name": "Ubr2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A8I5YBG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5YBG5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A8I5YBG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5YBG5" } ] } ] }, { "uniprot_ac": "A0A8I5ZZN6", "gene_name": "Ubr1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A8I5ZZN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZN6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A8I5ZZN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZN6" } ] } ] }, { "uniprot_ac": "A0A8I6AM23", "gene_name": "Jak1", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "A0A8I6AM23", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AM23" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "A0A8I6AM23", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AM23" } ] } ] }, { "uniprot_ac": "B1H278", "gene_name": "Trim11", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "B1H278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H278" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "B1H278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H278" } ] } ] }, { "uniprot_ac": "B2GV24", "gene_name": "Ufl1", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "B2GV24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV24" } ] } ] }, { "uniprot_ac": "B5DFI8", "gene_name": "Ube2s", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "B5DFI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFI8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "B5DFI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFI8" } ] } ] }, { "uniprot_ac": "D3Z8X6", "gene_name": "Dtx3l", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3Z8X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3Z8X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X6" } ] } ] }, { "uniprot_ac": "D3ZBM4", "gene_name": "Rnf182", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM4" } ] } ] }, { "uniprot_ac": "D3ZBM7", "gene_name": "Hace1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM7" } ] } ] }, { "uniprot_ac": "D3ZD03", "gene_name": "Tyk2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "D3ZD03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZD03" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "D3ZD03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZD03" } ] } ] }, { "uniprot_ac": "D3ZDI6", "gene_name": "Mylip", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZDI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDI6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZDI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDI6" } ] } ] }, { "uniprot_ac": "D3ZDK2", "gene_name": "Ube2d1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] } ] }, { "uniprot_ac": "D3ZFK0", "gene_name": "Rnf144b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZFK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFK0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZFK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFK0" } ] } ] }, { "uniprot_ac": "D3ZHB7", "gene_name": "Ube3c", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZHB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHB7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZHB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHB7" } ] } ] }, { "uniprot_ac": "D3ZJB8", "gene_name": "Arih2", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZJB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZJB8" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZJB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZJB8" } ] } ] }, { "uniprot_ac": "D3ZLS5", "gene_name": "Hectd1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZLS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLS5" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZLS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLS5" } ] } ] }, { "uniprot_ac": "D3ZS02", "gene_name": "Cbll1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZS02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZS02" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZS02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZS02" } ] } ] }, { "uniprot_ac": "D3ZVM4", "gene_name": "Trim71", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVM4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVM4" } ] } ] }, { "uniprot_ac": "D3ZXK7", "gene_name": "Rnf123", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZXK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZXK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK7" } ] } ] }, { "uniprot_ac": "D3ZXM0", "gene_name": "Rnf19a", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXM0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXM0" } ] } ] }, { "uniprot_ac": "D4A1V8", "gene_name": "Dzip3", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4A1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1V8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D4A1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1V8" } ] } ] }, { "uniprot_ac": "D4A8H3", "gene_name": "Uba6", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "D4A8H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8H3" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "D4A8H3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8H3" } ] } ] }, { "uniprot_ac": "D4ABK2", "gene_name": "Rnf217", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D4ABK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABK2" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D4ABK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABK2" } ] } ] }, { "uniprot_ac": "D4ACF2", "gene_name": "Trim21", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4ACF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACF2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D4ACF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACF2" } ] } ] }, { "uniprot_ac": "D4ADD3", "gene_name": "Hecw2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4ADD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADD3" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D4ADD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADD3" } ] } ] }, { "uniprot_ac": "F1LP64", "gene_name": "Trip12", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1LP64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP64" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1LP64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP64" } ] } ] }, { "uniprot_ac": "F1M3F2", "gene_name": "Smurf2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M3F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3F2" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1M3F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3F2" } ] } ] }, { "uniprot_ac": "F1M7B8", "gene_name": "Ube3a", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M7B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7B8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1M7B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7B8" } ] } ] }, { "uniprot_ac": "F1M9Q3", "gene_name": "Ltn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M9Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M9Q3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "F1M9Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M9Q3" } ] } ] }, { "uniprot_ac": "G3V930", "gene_name": "Rnf41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "G3V930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V930" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "G3V930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V930" } ] } ] }, { "uniprot_ac": "O88846", "gene_name": "Rnf4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O88846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88846" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O88846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88846" } ] } ] }, { "uniprot_ac": "P24392", "gene_name": "Pex2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P24392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24392" } ] } ] }, { "uniprot_ac": "P50545", "gene_name": "Hck", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P50545", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50545" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P50545", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50545" } ] } ] }, { "uniprot_ac": "P59722", "gene_name": "Egln1", "activity": [ { "ec_number": "1.14.11.29", "activity": "2-oxoglutarate + L-prolyl-[hypoxia-inducible factor alpha subunit] + O2 = CO2 + succinate + trans-4-hydroxy-L-prolyl-[hypoxia-inducible factor alpha subunit].", "evidence": [ { "id": "P59722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59722" } ] }, { "ec_number": "1.14.11.29", "activity": "", "evidence": [ { "id": "P59722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59722" } ] } ] }, { "uniprot_ac": "P61078", "gene_name": "Ube2d3", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] } ] }, { "uniprot_ac": "P62255", "gene_name": "Ube2g1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62255" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62255" } ] } ] }, { "uniprot_ac": "P62839", "gene_name": "Ube2d2", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] } ] }, { "uniprot_ac": "P63149", "gene_name": "Ube2b", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P63149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63149" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P63149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63149" } ] } ] }, { "uniprot_ac": "Q07014", "gene_name": "Lyn", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q07014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07014" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q07014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07014" } ] } ] }, { "uniprot_ac": "Q2TL32", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] } ] }, { "uniprot_ac": "Q3B7D1", "gene_name": "Ube2z", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q3B7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3B7D1" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q3B7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3B7D1" } ] } ] }, { "uniprot_ac": "Q3T1H6", "gene_name": "Ube3d", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3T1H6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1H6" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q3T1H6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1H6" } ] } ] }, { "uniprot_ac": "Q4V8J2", "gene_name": "Ube2l6", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q4V8J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q4V8J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J2" } ] } ] }, { "uniprot_ac": "Q5BK82", "gene_name": "Trim69", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5BK82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK82" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5BK82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK82" } ] } ] }, { "uniprot_ac": "Q5PQN1", "gene_name": "Herc4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5PQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQN1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q5PQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQN1" } ] } ] }, { "uniprot_ac": "Q5U203", "gene_name": "Ube2f", "activity": [ { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "Q5U203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U203" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "Q5U203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U203" } ] } ] }, { "uniprot_ac": "Q5U300", "gene_name": "Uba1", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "Q5U300", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U300" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "Q5U300", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U300" } ] } ] }, { "uniprot_ac": "Q5XIQ4", "gene_name": "Mgrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5XIQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIQ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5XIQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIQ4" } ] } ] }, { "uniprot_ac": "Q62630", "gene_name": "Egln3", "activity": [ { "ec_number": "1.14.11.-", "activity": "", "evidence": [ { "id": "Q62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62630" } ] }, { "ec_number": "1.14.11.29", "activity": "2-oxoglutarate + L-prolyl-[hypoxia-inducible factor alpha subunit] + O2 = CO2 + succinate + trans-4-hydroxy-L-prolyl-[hypoxia-inducible factor alpha subunit].", "evidence": [ { "id": "Q62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62630" } ] } ] }, { "uniprot_ac": "Q62689", "gene_name": "Jak2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q62689", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62689" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q62689", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62689" } ] } ] }, { "uniprot_ac": "Q62921", "gene_name": "Rbck1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q62921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62921" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q62921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62921" } ] } ] }, { "uniprot_ac": "Q62940", "gene_name": "Nedd4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q62940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62940" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q62940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62940" } ] } ] }, { "uniprot_ac": "Q63364", "gene_name": "Pja2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q63364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63364" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q63364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63364" } ] } ] }, { "uniprot_ac": "Q64725", "gene_name": "Syk", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q64725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64725" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q64725", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64725" } ] } ] }, { "uniprot_ac": "Q66H62", "gene_name": "Cyld", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q66H62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H62" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q66H62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H62" } ] } ] }, { "uniprot_ac": "Q66H79", "gene_name": "Trim32", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q66H79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H79" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q66H79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H79" } ] } ] }, { "uniprot_ac": "Q68LP1", "gene_name": "Mib2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q68LP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68LP1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q68LP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68LP1" } ] } ] }, { "uniprot_ac": "Q6AXU4", "gene_name": "Rnf181", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6AXU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXU4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6AXU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXU4" } ] } ] }, { "uniprot_ac": "Q6AYH3", "gene_name": "Rnf34", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6AYH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYH3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6AYH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYH3" } ] } ] }, { "uniprot_ac": "Q6J2U6", "gene_name": "Rnf114", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6J2U6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6J2U6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6J2U6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6J2U6" } ] } ] }, { "uniprot_ac": "Q6MFZ5", "gene_name": "Trim39", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6MFZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MFZ5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6MFZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MFZ5" } ] } ] }, { "uniprot_ac": "Q6P7A2", "gene_name": "Ube4a", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6P7A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6P7A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A2" } ] } ] }, { "uniprot_ac": "Q6Y290", "gene_name": "Rnf130", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6Y290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Y290" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6Y290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Y290" } ] } ] }, { "uniprot_ac": "Q71F54", "gene_name": "Sh3rf1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q71F54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71F54" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q71F54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71F54" } ] } ] }, { "uniprot_ac": "Q810I1", "gene_name": "Trim50", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q810I1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q810I1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I1" } ] } ] }, { "uniprot_ac": "Q8K4S7", "gene_name": "Cblb", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8K4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8K4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S7" } ] } ] }, { "uniprot_ac": "Q8R4T2", "gene_name": "Siah2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8R4T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4T2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8R4T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4T2" } ] } ] }, { "uniprot_ac": "Q91Z63", "gene_name": "Trim63", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91Z63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z63" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91Z63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z63" } ] } ] }, { "uniprot_ac": "Q91ZY8", "gene_name": "Trim9", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91ZY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZY8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91ZY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZY8" } ] } ] }, { "uniprot_ac": "Q920M9", "gene_name": "Siah1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q920M9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920M9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q920M9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920M9" } ] } ] }, { "uniprot_ac": "Q99MI7", "gene_name": "Uba3", "activity": [ { "ec_number": "6.2.1.64", "activity": "ATP + [NEDD8 protein] + [E1 NEDD8-activating enzyme]-L-cysteine = AMP + diphosphate + [E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine.", "evidence": [ { "id": "Q99MI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MI7" } ] }, { "ec_number": "6.2.1.64", "activity": "", "evidence": [ { "id": "Q99MI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MI7" } ] } ] }, { "uniprot_ac": "Q99PD2", "gene_name": "Rnf138", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99PD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PD2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99PD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PD2" } ] } ] }, { "uniprot_ac": "Q9EQX9", "gene_name": "Ube2n", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9EQX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQX9" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9EQX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQX9" } ] } ] }, { "uniprot_ac": "Q9JK66", "gene_name": "Prkn", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] }, { "ec_number": "6.3.2.19", "activity": "", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }