{ "uniprot_canonical_ac": "P62774-1", "uniprot_ac": "P62774", "uniprot_id": "MTPN_MOUSE", "mass": { "chemical_mass": 12861.0, "monoisotopic_mass": 12861.0 }, "refseq": { "ac": "NP_032124", "name": "myotrophin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" }, "gene_names": [ { "name": "Mtpn", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P62774", "id": "P62774" }, { "name": "5033418D15Rik; Gcdp; V1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124", "id": "NP_032124" }, { "name": "Gcdp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62774", "id": "P62774" }, { "name": "Mtpn", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124", "id": "NP_032124" } ], "protein_names": [ { "name": "Myotrophin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P62774" }, { "name": "Granule cell differentiation protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62774" }, { "name": "Protein V-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62774" }, { "name": "myotrophin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124", "id": "NP_032124" }, { "name": "protein V-1; granule cell differentiation protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124", "id": "NP_032124" } ], "function": [ { "annotation": "MiR-375 enhances palmitate-induced lipoapoptosis in insulin-secreting NIT-1 cells (a NOD-derived beta-cell line) by repressing myotrophin (V1) protein expression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" }, { "database": "PubMed", "id": "20224724", "url": "https://glygen.org/publication/PubMed/20224724" } ] }, { "annotation": "Our data argue that a large pool of freely diffusing, inactive capping protein (CP:V-1) feeds, via CARMIL-driven complex exchange, the formation of weak-capping complexes (CP:CARMIL) at the plasma membrane of protruding edges.", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" }, { "database": "PubMed", "id": "24778263", "url": "https://glygen.org/publication/PubMed/24778263" } ] }, { "annotation": "Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy (By similarity). Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer.", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774#function" }, { "database": "PubMed", "id": "20538588", "url": "https://glygen.org/publication/PubMed/20538588" } ] }, { "annotation": "Rat neonatal cardiac myocytes incubated with myotrophin showed an increase in c-myc, c-fos, and c-jun RNA levels and an increase in connexin 43, atrial natriuretic factor, skeletal alpha-actin, and total myosin transcript levels.", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" }, { "database": "PubMed", "id": "8428777", "url": "https://glygen.org/publication/PubMed/8428777" } ] } ], "disease": [ { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:12930", "recommended_name": { "id": "DOID:12930", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12930", "name": "dilated cardiomyopathy", "description": "An intrinsic cardiomyopathy that is characterized by an an enlarged heart and damage to the myocardium causing the heart to pump blood inefficiently." }, "synonyms": [ { "id": "DOID:12930", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12930", "name": "primary dilated cardiomyopathy", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy 1A", "description": "Familial dilated cardiomyopathy with conduction defect due to LMNA mutation is a rare familial dilated cardiomyopathy characterized by left ventricular enlargement and/or reduced systolic function preceded or accompanied by significant conduction system disease and/or arrhythmias including bradyarrhythmias, supraventricular or ventricular arrhythmias. Disease onset is usually in early to mid-adulthood. Sudden cardiac death may occur and may be the presenting symptom. In some cases, it is associated with skeletal myopathy and elevated serum creatine kinase." }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "CDCD1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "LMNA familial isolated dilated cardiomyopathy", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy dilated with conduction defect type 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, type 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy type 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy with conduction defect 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "familial dilated cardiomyopathy with conduction defect due to LMNA mutation", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "familial isolated dilated cardiomyopathy caused by mutation in LMNA", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, congestive", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, with conduction defect 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, familial idiopathic", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, idiopathic dilated", "description": "" }, { "id": "MIM:115200", "resource": "MIM", "url": "https://www.omim.org/entry/115200", "name": "Cardiomyopathy, dilated, 1A", "description": "Cardiomyopathy, dilated, 1A" } ], "evidence": [ { "id": "12930", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12930" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mtpn", "url": "https://www.uniprot.org/uniprot/P62774", "locus": { "chromosome": "6", "start_pos": 35485841, "end_pos": 35516823, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000029840", "url": "https://www.ensembl.org/id/ENSMUSG00000029840" } ] } } ], "crossref": [ { "id": "ENSMUSG00000029840", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029840", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "14489", "url": "https://www.ncbi.nlm.nih.gov/gene/14489", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P62774", "url": "https://www.ebi.ac.uk/intact/interactors/id:P62774*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14489", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14489", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "99445", "url": "http://www.informatics.jax.org/marker/MGI:99445", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P62774", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P62774", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "WAIKNGD", "url": "https://omabrowser.org/oma/group/WAIKNGD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5475373at2759", "url": "http://www.orthodb.org/?query=5475373at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24189", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24189", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24189:SF52", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24189:SF52", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2KXP", "url": "https://www.rcsb.org/structure/2KXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF12796", "url": "http://pfam.xfam.org/family/PF12796", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13857", "url": "http://pfam.xfam.org/family/PF13857", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P62774", "url": "http://purl.obolibrary.org/obo/PR_P62774", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0J9YV46", "url": "https://www.uniprot.org/uniprot/A0A0J9YV46", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YV46-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YV46-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62774-1", "url": "https://www.uniprot.org/uniprot/P62774-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ", "length": 118, "header": "sp|P62774-1|MTPN_MOUSE Isoform 1 of Myotrophin OS=Mus musculus OX=10090 GN=Mtpn PE=1 SV=2 CANONICAL=P62774-1" }, "isoforms": [ { "isoform_ac": "A0A0J9YV46-1", "url": "", "sequence": { "sequence": "MCDKEFMWALKNGDLDEGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH", "length": 73, "header": "tr|A0A0J9YV46-1|A0A0J9YV46_MOUSE Computationally mapped isoform of Myotrophin OS=Mus musculus OX=10090 GN=Mtpn PE=1 SV=1 CANONICAL=P62774-1" }, "locus": { "chromosome": "6", "start_pos": 35516545, "end_pos": 35498865, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000201026.2", "url": "https://www.ensembl.org/id/ENSMUST00000201026.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000144482.2", "url": "https://www.ensembl.org/id/ENSMUSP00000144482.2" } ] } }, { "isoform_ac": "P62774-1", "url": "", "sequence": { "sequence": "MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ", "length": 118, "header": "sp|P62774-1|MTPN_MOUSE Isoform 1 of Myotrophin OS=Mus musculus OX=10090 GN=Mtpn PE=1 SV=2 CANONICAL=P62774-1" }, "locus": { "chromosome": "6", "start_pos": 35516545, "end_pos": 35489169, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000031866", "url": "https://www.ensembl.org/id/ENSMUST00000031866" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000031866", "url": "https://www.ensembl.org/id/ENSMUSP00000031866" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P62774", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P62774" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" } ] } ], "phosphorylation": [ { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "site_lbl": "Thr31" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "miR-375 enhances palmitate-induced lipoapoptosis in insulin-secreting NIT-1 cells by repressing myotrophin (V1) protein expression.", "journal": "International journal of clinical and experimental pathology", "date": "2010", "authors": "Li Y, Xu X, Liang Y, Liu S, Xiao H, Li F, Cheng H, Fu Z", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" } ], "reference": [ { "type": "PubMed", "id": "20224724", "url": "https://glygen.org/publication/PubMed/20224724" } ] }, { "title": "Structural basis for capping protein sequestration by myotrophin (V-1).", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Tjandra N., Fujiwara I., Hammer J.A. III, Zwolak A.", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "reference": [ { "type": "PubMed", "id": "20538588", "url": "https://glygen.org/publication/PubMed/20538588" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" }, { "database": "UniProtKB", "id": "A0A0J9YV46", "url": "https://www.uniprot.org/uniprot/A0A0J9YV46" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Capping protein regulatory cycle driven by CARMIL and V-1 may promote actin network assembly at protruding edges.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Fujiwara I, Remmert K, Piszczek G, Hammer JA", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" } ], "reference": [ { "type": "PubMed", "id": "24778263", "url": "https://glygen.org/publication/PubMed/24778263" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P62774", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P62774" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "Isolation of cDNA clones encoding the mouse protein V-1.", "journal": "Gene", "date": "1995", "authors": "Pennica D, Shaw KJ, Luoh SM, Wood WI", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "reference": [ { "type": "PubMed", "id": "7607560", "url": "https://glygen.org/publication/PubMed/7607560" } ] }, { "title": "Myotrophin induces early response genes and enhances cardiac gene expression.", "journal": "Hypertension (Dallas, Tex. : 1979)", "date": "1993", "authors": "Mukherjee DP, McTiernan CF, Sen S", "evidence": [ { "database": "RefSeq", "id": "NP_032124", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032124" } ], "reference": [ { "type": "PubMed", "id": "8428777", "url": "https://glygen.org/publication/PubMed/8428777" } ] } ], "pathway": [ { "id": "mmu:14489", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14489", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P58546-1", "protein_name": "Myotrophin", "gene_name": "MTPN", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ", "length": 118 }, "evidence": [ { "id": "45236834", "url": "http://www.informatics.jax.org/homology/45236834", "database": "MGI" }, { "id": "P62774", "url": "https://omabrowser.org/oma/group/P62774/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P62775-1", "protein_name": "Myotrophin", "gene_name": "Mtpn", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ", "length": 118 }, "evidence": [ { "id": "45236834", "url": "http://www.informatics.jax.org/homology/45236834", "database": "MGI" }, { "id": "P62774", "url": "https://omabrowser.org/oma/group/P62774/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "skeletal muscle tissue regeneration", "id": "GO:0043403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043403", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "positive regulation of macromolecule biosynthetic process", "id": "GO:0010557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010557", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "regulation of barbed-end actin filament capping", "id": "GO:2000812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000812", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "positive regulation of cell growth", "id": "GO:0030307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030307", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "positive regulation of protein metabolic process", "id": "GO:0051247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051247", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "catecholamine metabolic process", "id": "GO:0006584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006584", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "striated muscle cell differentiation", "id": "GO:0051146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051146", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "positive regulation of cardiac muscle hypertrophy", "id": "GO:0010613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010613", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "cerebellar granule cell differentiation", "id": "GO:0021707", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021707", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "regulation of cell size", "id": "GO:0008361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008361", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" }, { "name": "F-actin capping protein complex", "id": "GO:0008290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008290", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P62774", "url": "https://www.uniprot.org/uniprot/P62774" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }