{ "uniprot_canonical_ac": "P62651-1", "uniprot_ac": "P62651", "uniprot_id": "ERI1_YEAST", "mass": { "chemical_mass": 8039.0, "monoisotopic_mass": 8039.0 }, "refseq": { "ac": "NP_690846", "name": "Eri1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_690846" }, "gene_names": [ { "name": "ERI1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P62651", "id": "P62651" }, { "name": "ERI1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_690846", "id": "NP_690846" }, { "name": "RIN1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_690846", "id": "NP_690846" }, { "name": "RIN1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P62651", "id": "P62651" } ], "protein_names": [ { "name": "Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P62651" }, { "name": "Endoplasmic reticulum-associated Ras inhibitor protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62651" }, { "name": "Eri1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_690846", "id": "NP_690846" }, { "name": "GPI-GlcNAc transferase complex subunit ERI1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62651" }, { "name": "GPI-GnT subunit ERI1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P62651" } ], "function": [ { "annotation": "Probable component of the GPI-GlcNAc transferase (GPI-GnT) complex in the endoplasmic reticulum, a complex that catalyzes transfer of GlcNAc from UDP-GlcNAc to an acceptor phosphatidylinositol, the first step in the production of GPI-anchors for cell surface proteins. Ras may inhibit the enzyme activity of the GPI-GnT complex via the association between ERI1 and RAS2.", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651#function" }, { "database": "PubMed", "id": "15163411", "url": "https://glygen.org/publication/PubMed/15163411" }, { "database": "PubMed", "id": "12832483", "url": "https://glygen.org/publication/PubMed/12832483" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "common_name": "Yeast" } ], "gene": [ { "name": "ERI1", "url": "https://www.uniprot.org/uniprot/P62651", "locus": { "chromosome": "XVI", "start_pos": 366529, "end_pos": 366735, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YPL096C-A", "url": "https://www.ensembl.org/id/YPL096C-A" } ] } } ], "crossref": [ { "id": "856008", "url": "https://www.ncbi.nlm.nih.gov/gene/856008", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P62651", "url": "https://www.ebi.ac.uk/intact/interactors/id:P62651*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YPL096C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL096C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WALIAWC", "url": "https://omabrowser.org/oma/group/WALIAWC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2015674at2759", "url": "http://www.orthodb.org/?query=2015674at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P62651", "url": "http://purl.obolibrary.org/obo/PR_P62651", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_690846", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_690846", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028423", "url": "https://www.yeastgenome.org/locus/S000028423", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P62651-1", "url": "https://www.uniprot.org/uniprot/P62651-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSEMFASSKDE", "length": 68, "header": "sp|P62651-1|ERI1_YEAST Isoform 1 of Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit OS=Saccharomyces cerevisiae S288C OX=559292 GN=ERI1 PE=1 SV=1 CANONICAL=P62651-1" }, "isoforms": [ { "isoform_ac": "P62651-1", "url": "", "sequence": { "sequence": "MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSEMFASSKDE", "length": 68, "header": "sp|P62651-1|ERI1_YEAST Isoform 1 of Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit OS=Saccharomyces cerevisiae S288C OX=559292 GN=ERI1 PE=1 SV=1 CANONICAL=P62651-1" }, "locus": { "chromosome": "XVI", "start_pos": 366735, "end_pos": 366532, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YPL096C-A_mRNA", "url": "https://www.ensembl.org/id/YPL096C-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YPL096C-A", "url": "https://www.ensembl.org/id/YPL096C-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A novel Ras inhibitor, Eri1, engages yeast Ras at the endoplasmic reticulum.", "journal": "Mol. Cell. Biol.", "date": "2003", "authors": "Romeo M.J., Levin D.E., Vay H.A., Sobering A.K.", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "reference": [ { "type": "PubMed", "id": "12832483", "url": "https://glygen.org/publication/PubMed/12832483" } ] }, { "title": "Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER.", "journal": "Cell", "date": "2004", "authors": "Riezman H., Watanabe R., Orlean P., Specht C.A., Romeo M.J., Levin D.E., Yan B.C., Sobering A.K.", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "reference": [ { "type": "PubMed", "id": "15163411", "url": "https://glygen.org/publication/PubMed/15163411" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "reference": [ { "type": "PubMed", "id": "9169875", "url": "https://glygen.org/publication/PubMed/9169875" } ] } ], "pathway": [ { "id": "sce:YPL096C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPL096C-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex", "id": "GO:0000506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000506", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" }, { "name": "GPI anchor biosynthetic process", "id": "GO:0006506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006506", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" }, { "name": "fungal-type cell wall organization", "id": "GO:0031505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031505", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "GTPase inhibitor activity", "id": "GO:0005095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005095", "evidence": [ { "database": "UniProtKB", "id": "P62651", "url": "https://www.uniprot.org/uniprot/P62651" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 31, "end_pos": 33, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }