{ "uniprot_canonical_ac": "P61169-1", "uniprot_ac": "P61169", "uniprot_id": "DRD2_RAT", "mass": { "chemical_mass": 50904.0, "monoisotopic_mass": 50904.0 }, "refseq": { "ac": "NP_036679", "name": "D(2) dopamine receptor isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, "gene_names": [ { "name": "Drd2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P61169", "id": "P61169" }, { "name": "Drd2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679", "id": "NP_036679" } ], "protein_names": [ { "name": "D(2) dopamine receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P61169" }, { "name": "D(2) dopamine receptor isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679", "id": "NP_036679" }, { "name": "Dopamine D2 receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P61169" }, { "name": "d(2) dopamine receptor; dopamine receptor 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679", "id": "NP_036679" } ], "function": [ { "annotation": "Brain D2-Like Dopamine Receptor Distribution in Rats with Different Types of Genetic Epilepsy.", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, { "database": "PubMed", "id": "37208583", "url": "https://glygen.org/publication/PubMed/37208583" } ] }, { "annotation": "Commentary on ''Novel Interaction of the Dopamine D2 Receptor and the Ca(2+) Binding Protein S100B: Role in D2 Receptor Function''.", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, { "database": "PubMed", "id": "34045267", "url": "https://glygen.org/publication/PubMed/34045267" } ] }, { "annotation": "Dopamine D2 receptor regulates cortical synaptic pruning in rodents. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, { "database": "PubMed", "id": "34750364", "url": "https://glygen.org/publication/PubMed/34750364" } ] }, { "annotation": "Dopamine receptor 2 downregulation and brain-derived neurotrophic factor upregulation in the paraventricular nucleus are correlated with brown adipose tissue thermogenesis in rats with bilateral substantia nigra lesions.", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, { "database": "PubMed", "id": "34454019", "url": "https://glygen.org/publication/PubMed/34454019" } ] }, { "annotation": "Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (PubMed:1321233). Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169#function" }, { "database": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" }, { "database": "UniProtKB", "id": "P61168", "url": "https://www.uniprot.org/uniprot/P61168#function" } ] }, { "annotation": "Dysregulation of striatal dopamine D2/D3 receptor-mediated by hypocretin induces depressive behaviors in rats.", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" }, { "database": "PubMed", "id": "36638964", "url": "https://glygen.org/publication/PubMed/36638964" } ] } ], "disease": [ { "disease_id": "DOID:0050742", "recommended_name": { "id": "DOID:0050742", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050742", "name": "nicotine dependence", "description": "A substance dependence that is characterized by a physical dependence on nicotine." }, "synonyms": [ { "id": "DOID:0050742", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050742", "name": "tobacco use disorder", "description": "" } ], "evidence": [ { "id": "0050742", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050742" } ] }, { "disease_id": "DOID:0080855", "recommended_name": { "id": "DOID:0080855", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080855", "name": "Parkinsonism", "description": "A movement disorder that is characterized by disturbances of balance, gait and posture." }, "synonyms": [], "evidence": [ { "id": "0080855", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080855" } ] }, { "disease_id": "DOID:0081292", "recommended_name": { "id": "DOID:0081292", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081292", "name": "traumatic brain injury", "description": "A brain disease that is characterized by brain dysfunction caused by an outside force, usually a violent blow to the head." }, "synonyms": [], "evidence": [ { "id": "0081292", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081292" } ] }, { "disease_id": "DOID:10024", "recommended_name": { "id": "DOID:10024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10024", "name": "migraine with aura", "description": "A migraine characterized by migraine headache which is preceded or accompanied by a transient focal neurological phenomenon." }, "synonyms": [ { "id": "DOID:10024", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10024", "name": "classic migraine", "description": "" }, { "id": "MONDO:0012331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012331", "name": "migraine with aura, susceptibility to, 9", "description": "" }, { "id": "MONDO:0012331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012331", "name": "migraine with aura, susceptibility to, 9", "description": "" }, { "id": "MONDO:0012331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012331", "name": "migraine with aura, susceptibility to, type 9", "description": "" }, { "id": "MONDO:0012331", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012331", "name": "Mgr9", "description": "" }, { "id": "MONDO:0012210", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012210", "name": "migraine with aura, susceptibility to, 7", "description": "" }, { "id": "MONDO:0012210", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012210", "name": "migraine with aura, susceptibility to, 7", "description": "" }, { "id": "MONDO:0012210", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012210", "name": "migraine with aura, susceptibility to, type 7", "description": "" }, { "id": "MONDO:0012210", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012210", "name": "Mgr7", "description": "" } ], "evidence": [ { "id": "10024", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10024" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:11119", "recommended_name": { "id": "DOID:11119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11119", "name": "Gilles de la Tourette syndrome", "description": "A tic disorder that is characterized by multiple physical (motor) tics and at least one vocal (phonic) tic present for more than a year." }, "synonyms": [ { "id": "DOID:11119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11119", "name": "Guinon's disease", "description": "" }, { "id": "DOID:11119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11119", "name": "Psychogenic tics", "description": "" }, { "id": "DOID:11119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11119", "name": "Tourette syndrome", "description": "" }, { "id": "DOID:11119", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11119", "name": "motor-verbal tic disorder", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Tourette syndrome", "description": "A neurologic disorder caused by defective metabolism of the neurotransmitters in the brain. It is characterized by repeated involuntary movements (motor tics) and uncontrollable vocal sounds (vocal tics). The symptoms are usually manifested before the age of eighteen." }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Guinon's disease", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Tourette disease", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Tourette syndrome", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Tourette's syndrome", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "motor-verbal tic disorder", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "psychogenic tics", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "GTS", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Gilles De 50A Tourette syndrome", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Gilles de la Tourette syndrome", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "Tourette disorder", "description": "" }, { "id": "MONDO:0007661", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007661", "name": "chronic motor tics", "description": "" }, { "id": "MIM:137580", "resource": "MIM", "url": "https://www.omim.org/entry/137580", "name": "Gilles de la Tourette syndrome", "description": "Gilles de la Tourette syndrome" } ], "evidence": [ { "id": "11119", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11119" } ] }, { "disease_id": "DOID:12700", "recommended_name": { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinemia", "description": "An acquired metabolic disease that has_material_basis_in the presence of abnormally-high levels of prolactin in the blood." }, "synonyms": [ { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Chiari-Frommel syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Pregnancy-related A-G syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinaemia", "description": "" } ], "evidence": [ { "id": "12700", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12700" } ] }, { "disease_id": "DOID:1307", "recommended_name": { "id": "DOID:1307", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1307", "name": "dementia", "description": "A cognitive disorder resulting from a loss of brain function affecting memory, thinking, language, judgement and behavior." }, "synonyms": [], "evidence": [ { "id": "1307", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1307" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:1596", "recommended_name": { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "depressive disorder", "description": "A mood disorder characterized by persistent sadness, emptiness, or irritability and decreased ability to function." }, "synonyms": [ { "id": "DOID:1596", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1596", "name": "mental depression", "description": "" } ], "evidence": [ { "id": "1596", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1596" } ] }, { "disease_id": "DOID:1742", "recommended_name": { "id": "DOID:1742", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1742", "name": "drug psychosis", "description": "" }, "synonyms": [ { "id": "DOID:1742", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1742", "name": "Drug-induced psychosis", "description": "" }, { "id": "DOID:1742", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1742", "name": "Drug-induced psychotic disorder", "description": "" } ], "evidence": [ { "id": "1742", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1742" } ] }, { "disease_id": "DOID:2030", "recommended_name": { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety disorder", "description": "A cognitive disorder that involves an excessive, irrational dread of everyday situations." }, "synonyms": [ { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety", "description": "" }, { "id": "DOID:2030", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2030", "name": "anxiety state", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "anxiety-related personality traits", "description": "" }, { "id": "MONDO:0011918", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011918", "name": "harm avoidance", "description": "" } ], "evidence": [ { "id": "2030", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2030" } ] }, { "disease_id": "DOID:2316", "recommended_name": { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "brain ischemia", "description": "An ischemia that is characterized by insufficient blood flow to the brain to meet metabolic demand." }, "synonyms": [ { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischaemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "cerebral ischemia", "description": "" } ], "evidence": [ { "id": "2316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2316" } ] }, { "disease_id": "DOID:2560", "recommended_name": { "id": "DOID:2560", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2560", "name": "morphine dependence", "description": "An opiate dependence that involves the continued use of morphine despite despite problems related to use of the substance." }, "synonyms": [], "evidence": [ { "id": "2560", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2560" } ] }, { "disease_id": "DOID:3602", "recommended_name": { "id": "DOID:3602", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3602", "name": "toxic encephalopathy", "description": "A nervous system disease that results from exposure to neurotoxicants and is characterized by an altered mental status, memory loss, and visual problems." }, "synonyms": [ { "id": "DOID:3602", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3602", "name": "neurotoxicity", "description": "" }, { "id": "DOID:3602", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3602", "name": "neurotoxicity syndrome", "description": "" } ], "evidence": [ { "id": "3602", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3602" } ] }, { "disease_id": "DOID:446", "recommended_name": { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "primary hyperaldosteronism", "description": "An adrenal gland hyperfunction disease that results in the overproduction of aldosterone by the adrenal glands." }, "synonyms": [ { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "Cushing syndrome", "description": "" }, { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "Cushing's syndrome", "description": "" }, { "id": "DOID:446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:446", "name": "hyperaldosteronism", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "familial hyperaldosteronism type III", "description": "Familial hyperaldosteronism type III (FH-III) is a rare heritable form of primary aldosteronism (PA) that is characterized by early-onset severe hypertension, non glucocorticoid-remediable hyperaldosteronism, overproduction of 18-oxocortisol and 18-hydroxycortisol, and profound hypokalemia." }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH-III", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "familial hyperaldosteronism type 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "FH III", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "HALD3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "hyperaldosteronism, familial, type 3", "description": "" }, { "id": "MONDO:0013359", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013359", "name": "hyperaldosteronism, familial, type III", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial hyperaldosteronism type II", "description": "Familial hyperaldosteronism type II (FH-II) is a heritable form of primary aldosteronism (PA) characterized by hypertension of varying severity, and non glucocticoid remediable hyperaldosteronism." }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH-II", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial adrenal adenoma", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "familial hyperaldosteronism type 2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FH 2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "FHII", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "HALD2", "description": "" }, { "id": "MONDO:0011576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011576", "name": "hyperaldosteronism, familial, type II", "description": "" }, { "id": "MIM:613677", "resource": "MIM", "url": "https://www.omim.org/entry/613677", "name": "Hyperaldosteronism, familial, 3", "description": "Hyperaldosteronism, familial, 3" }, { "id": "MIM:605635", "resource": "MIM", "url": "https://www.omim.org/entry/605635", "name": "Hyperaldosteronism, familial, 2", "description": "Hyperaldosteronism, familial, 2" } ], "evidence": [ { "id": "446", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:446" } ] }, { "disease_id": "DOID:480", "recommended_name": { "id": "DOID:480", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:480", "name": "movement disease", "description": "A brain disease that is characterized by a clinical syndrome of either hyperkinetic movement or hyperkinetic movement unrelated to weakness or spasticity." }, "synonyms": [], "evidence": [ { "id": "480", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:480" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:5425", "recommended_name": { "id": "DOID:5425", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5425", "name": "ovarian hyperstimulation syndrome", "description": "An ovarian disease that is characterized by cystic enlargement of the ovaries and a fluid shift from the intravascular to the third space and has_symptom abdominal pain, has_symptom nausea and has_symptom vomiting. This disease is an iatrogenic complication of assisted reproduction technology." }, "synonyms": [ { "id": "DOID:5425", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5425", "name": "secondary Meig's syndrome", "description": "" }, { "id": "MONDO:0011972", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011972", "name": "ovarian hyperstimulation syndrome", "description": "A complication of ovulation induction in infertility treatment. It is graded by the severity of symptoms which include ovary enlargement, multiple ovarian follicles; ovarian cysts; ascites; and generalized edema. The full-blown syndrome may lead to renal failure, respiratory distress, and even death. Increased capillary permeability is caused by the vasoactive substances, such as vascular endothelial growth factors, secreted by the overly-stimulated ovaries." }, { "id": "MONDO:0011972", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011972", "name": "OHSS", "description": "" }, { "id": "MONDO:0011972", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011972", "name": "ovarian hyperstimulation syndrome", "description": "" }, { "id": "MONDO:0011972", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011972", "name": "secondary Meig's syndrome", "description": "" }, { "id": "MONDO:0011972", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011972", "name": "ovarian hyperstimulation syndrome, familial gestational spontaneous", "description": "" }, { "id": "MIM:608115", "resource": "MIM", "url": "https://www.omim.org/entry/608115", "name": "Ovarian hyperstimulation syndrome", "description": "Ovarian hyperstimulation syndrome" } ], "evidence": [ { "id": "5425", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5425" } ] }, { "disease_id": "DOID:783", "recommended_name": { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal disease", "description": "A chronic kidney disease is characterized by non-functioning kidneys, as the final stage in chronic kidney disease." }, "synonyms": [ { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal failure", "description": "" }, { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end-stage kidney disease", "description": "" } ], "evidence": [ { "id": "783", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:783" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] }, { "disease_id": "DOID:9975", "recommended_name": { "id": "DOID:9975", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9975", "name": "cocaine dependence", "description": "A drug dependence that is a psychological dependency on the regular use of cocaine." }, "synonyms": [], "evidence": [ { "id": "9975", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9975" } ] }, { "disease_id": "DOID:9976", "recommended_name": { "id": "DOID:9976", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9976", "name": "heroin dependence", "description": "An opiate dependence that involves the continued use of heroin despite problems related to use of the substance." }, "synonyms": [], "evidence": [ { "id": "9976", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9976" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 193, "end_pos": 193, "sequence_org": "S", "sequence_mut": "A", "comment": "Moderate decrease in ligand binding. 200-fold reduction of agonist-mediated cAMP inhibition.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" }, { "database": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" } ] }, { "start_pos": 194, "end_pos": 194, "sequence_org": "S", "sequence_mut": "A", "comment": "Small decrease in agonist binding. Complete loss of agonist-mediated cAMP inhibition.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" }, { "database": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" } ] }, { "start_pos": 197, "end_pos": 197, "sequence_org": "S", "sequence_mut": "A", "comment": "Small decrease in agonist binding. 18-fold reduction of agonist-mediated cAMP inhibition.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" }, { "database": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" } ] }, { "start_pos": 420, "end_pos": 420, "sequence_org": "S", "sequence_mut": "A", "comment": "Moderate decrease in ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" }, { "database": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "common_name": "Rat" } ], "gene": [ { "name": "Drd2", "url": "https://www.uniprot.org/uniprot/P61169", "locus": { "chromosome": "8", "start_pos": 49772875, "end_pos": 49708927, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000008428", "url": "https://www.ensembl.org/id/ENSRNOG00000008428" } ] } } ], "crossref": [ { "id": "ENSRNOG00000008428", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008428", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15309", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15309", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL339", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL339", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "24318", "url": "https://www.ncbi.nlm.nih.gov/gene/24318", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P61169", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61169*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000929", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000929", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001922", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001922", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:24318", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24318", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "APMDPLN", "url": "https://omabrowser.org/oma/group/APMDPLN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2999405at2759", "url": "http://www.orthodb.org/?query=2999405at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24248", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24248", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24248:SF87", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24248:SF87", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P61169", "url": "http://purl.obolibrary.org/obo/PR_P61169", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-390651", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390651", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2520", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2520", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P61169-1", "url": "https://www.uniprot.org/uniprot/P61169-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P61169-2", "url": "https://www.uniprot.org/uniprot/P61169-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC", "length": 444, "header": "sp|P61169-1|DRD2_RAT Isoform 1 of D(2) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd2 PE=1 SV=1 CANONICAL=P61169-1" }, "isoforms": [ { "isoform_ac": "P61169-1", "url": "", "sequence": { "sequence": "MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC", "length": 444, "header": "sp|P61169-1|DRD2_RAT Isoform 1 of D(2) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd2 PE=1 SV=1 CANONICAL=P61169-1" }, "locus": { "chromosome": "8", "start_pos": 49771804, "end_pos": 49759957, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000045944", "url": "https://www.ensembl.org/id/ENSRNOT00000045944" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000043759", "url": "https://www.ensembl.org/id/ENSRNOP00000043759" } ] } }, { "isoform_ac": "P61169-2", "url": "", "sequence": { "sequence": "MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC", "length": 415, "header": "sp|P61169-2|DRD2_RAT Isoform 2 of D(2) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd2 PE=1 SV=1 CANONICAL=P61169-1" }, "locus": { "chromosome": "8", "start_pos": 49771804, "end_pos": 49759957, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083419", "url": "https://www.ensembl.org/id/ENSRNOT00000083419" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074235", "url": "https://www.ensembl.org/id/ENSRNOP00000074235" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 17, "start_aa": "Asn", "end_pos": 17, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn17", "evidence": [ { "id": "P61169", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61169#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 23, "start_aa": "Asn", "end_pos": 23, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn23", "evidence": [ { "id": "P61169", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61169#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "P61169", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61169#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Association of the D2 dopamine receptor third cytoplasmic loop with spinophilin, a protein phosphatase-1-interacting protein.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Smith FD, Oxford GS, Milgram SL", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "10391935", "url": "https://glygen.org/publication/PubMed/10391935" } ] }, { "title": "Contributions of conserved serine residues to the interactions of ligands with dopamine D2 receptors.", "journal": "J. Neurochem.", "date": "1992", "authors": "Cox BA, Henningsen RA, Spanoyannis A, Neve RL, Neve KA", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "1321233", "url": "https://glygen.org/publication/PubMed/1321233" } ] }, { "title": "Molecular modelling of D2-like dopamine receptors.", "journal": "Biochem. J.", "date": "1992", "authors": "Livingstone CD, Strange PG, Naylor LH", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "1358063", "url": "https://glygen.org/publication/PubMed/1358063" } ] }, { "title": "CLIC6, a member of the intracellular chloride channel family, interacts with dopamine D(2)-like receptors.", "journal": "Brain Res. Mol. Brain Res.", "date": "2003", "authors": "Prieur F., Jeanneteau F., Sokoloff P., Diaz J., Griffon N.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "14499480", "url": "https://glygen.org/publication/PubMed/14499480" } ] }, { "title": "Dopamine responsiveness is regulated by targeted sorting of D2 receptors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Bartlett SE, Enquist J, Hopf FW, Lee JH, Gladher F, Kharazia V, Waldhoer M, Mailliard WS, Armstrong R, Bonci A, Whistler JL", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "16049099", "url": "https://glygen.org/publication/PubMed/16049099" } ] }, { "title": "G protein-coupled receptor kinase-mediated phosphorylation regulates post-endocytic trafficking of the D2 dopamine receptor.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Sibley D.R., Javitch J.A., Namkung Y., Dipace C.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "19332542", "url": "https://glygen.org/publication/PubMed/19332542" } ] }, { "title": "A second molecular form of D2 dopamine receptor in rat and bovine caudate nucleus.", "journal": "Nature", "date": "1990", "authors": "Chio CL, Hess GF, Graham RS, Huff RM", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2137198", "url": "https://glygen.org/publication/PubMed/2137198" } ] }, { "title": "Identification by sequence analysis of a second rat brain cDNA encoding the dopamine (D2) receptor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1990", "authors": "Wang Y., Miller J.C., Filer D.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2137336", "url": "https://glygen.org/publication/PubMed/2137336" } ] }, { "title": "Cloning of two additional catecholamine receptors from rat brain.", "journal": "FEBS Lett.", "date": "1990", "authors": "Nguyen T., Niznik H.B., O'Dowd B.F., Seeman P., Israel Y., Jarvie K.R., Tirpak A.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2138567", "url": "https://glygen.org/publication/PubMed/2138567" } ] }, { "title": "Two forms of the rat D2 dopamine receptor as revealed by the polymerase chain reaction.", "journal": "FEBS Lett.", "date": "1990", "authors": "Rao D.D., Kebabian J., MacKenzie R.G., McKelvy J.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2139615", "url": "https://glygen.org/publication/PubMed/2139615" } ] }, { "title": "Multiple D2 dopamine receptors produced by alternative RNA splicing.", "journal": "Nature", "date": "1989", "authors": "Sibley D.R., Monsma F.J. Jr., Gerfen C.R., Mahan L.C., McVittie L.D.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2480527", "url": "https://glygen.org/publication/PubMed/2480527" } ] }, { "title": "The dopamine D2 receptor: two molecular forms generated by alternative splicing.", "journal": "EMBO J.", "date": "1989", "authors": "Seeburg P.H., Bach A., Dal-Toso R., Ewert M., Herb A., Pritchett D.B., Shivers B.D., Sommer B.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2531656", "url": "https://glygen.org/publication/PubMed/2531656" } ] }, { "title": "D2 receptor, a missing exon.", "journal": "Nature", "date": "1989", "authors": "Saunders P.T.K., Inglis J.D., Eidne K.A., Taylor P.L., Zabavnik J.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2531846", "url": "https://glygen.org/publication/PubMed/2531846" } ] }, { "title": "Alternative splicing directs the expression of two D2 dopamine receptor isoforms.", "journal": "Nature", "date": "1989", "authors": "Emorine L.J., Riou J.-F., Giros B., Martres M.-P., Schwartz J.-C., Sokoloff P.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2531847", "url": "https://glygen.org/publication/PubMed/2531847" } ] }, { "title": "Cloning and expression of a rat D2 dopamine receptor cDNA.", "journal": "Nature", "date": "1988", "authors": "van Tol H.H.M., Grandy D.K., Civelli O., Salon J., Bunzow J.R., Christie M., Neve K.A., Albert P., Machida C.A.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "reference": [ { "type": "PubMed", "id": "2974511", "url": "https://glygen.org/publication/PubMed/2974511" } ] }, { "title": "Commentary on `Novel Interaction of the Dopamine D2 Receptor and the Ca(2+) Binding Protein S100B: Role in D2 Receptor Function`.", "journal": "Molecular pharmacology", "date": "2021", "authors": "Lee HJ, Rodriguez-Contreras D, Neve KA", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" } ], "reference": [ { "type": "PubMed", "id": "34045267", "url": "https://glygen.org/publication/PubMed/34045267" } ] }, { "title": "Dopamine receptor 2 downregulation and brain-derived neurotrophic factor upregulation in the paraventricular nucleus are correlated with brown adipose tissue thermogenesis in rats with bilateral substantia nigra lesions.", "journal": "Journal of chemical neuroanatomy", "date": "2021", "authors": "Zhang Y, Zhou L, Lian H, Zhang Y, Tong S, Wang Z", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" } ], "reference": [ { "type": "PubMed", "id": "34454019", "url": "https://glygen.org/publication/PubMed/34454019" } ] }, { "title": "Dopamine D2 receptor regulates cortical synaptic pruning in rodents.", "journal": "Nature communications", "date": "2021", "authors": "Zhang YQ, Lin WP, Huang LP, Zhao B, Zhang CC, Yin DM", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" } ], "reference": [ { "type": "PubMed", "id": "34750364", "url": "https://glygen.org/publication/PubMed/34750364" } ] }, { "title": "Dysregulation of striatal dopamine D2/D3 receptor-mediated by hypocretin induces depressive behaviors in rats.", "journal": "Journal of affective disorders", "date": "2023-03-15", "authors": "Chen Bing, Xu Jiangang, Chen Simiao, Mou Tingting, Wang Ying, Wang Haojun, Zhang Zhihan, Ren Feifan, Wang Zheng, Jin Kangyu, Lu Jing", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" } ], "reference": [ { "type": "PubMed", "id": "36638964", "url": "https://glygen.org/publication/PubMed/36638964" } ] }, { "title": "Brain D2-Like Dopamine Receptor Distribution in Rats with Different Types of Genetic Epilepsy.", "journal": "Doklady biological sciences : proceedings of the Academy of Sciences of the USSR, Biological sciences sections", "date": "2023-04", "authors": "Tsyba E T, Birioukova L M, Midzyanovskaya I S, Surina N M, Abbasova K R", "evidence": [ { "database": "RefSeq", "id": "NP_036679", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036679" } ], "reference": [ { "type": "PubMed", "id": "37208583", "url": "https://glygen.org/publication/PubMed/37208583" } ] } ], "pathway": [ { "id": "rno:24318", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24318", "resource": "KEGG Pathway" }, { "id": "R-RNO-390651", "name": "Dopamine receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390651", "resource": "Reactome", "description": "Dopamine receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "P14416-1", "protein_name": "D(2) dopamine receptor", "gene_name": "DRD2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC", "length": 443 }, "evidence": [ { "id": "45225407", "url": "http://www.informatics.jax.org/homology/45225407", "database": "MGI" }, { "id": "P61169", "url": "https://omabrowser.org/oma/group/P61169/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P61168-1", "protein_name": "D(2) dopamine receptor", "gene_name": "Drd2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC", "length": 444 }, "evidence": [ { "id": "45225407", "url": "http://www.informatics.jax.org/homology/45225407", "database": "MGI" }, { "id": "P61169", "url": "https://omabrowser.org/oma/group/P61169/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 116, "go_terms": [ { "name": "nervous system process involved in regulation of systemic arterial blood pressure", "id": "GO:0001976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001976", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "peristalsis", "id": "GO:0030432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030432", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "auditory behavior", "id": "GO:0031223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031223", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adenohypophysis development", "id": "GO:0021984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021984", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to histamine", "id": "GO:0034776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034776", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of circadian sleep/wake cycle, sleep", "id": "GO:0042321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042321", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of phosphoprotein phosphatase activity", "id": "GO:0043666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043666", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "acid secretion", "id": "GO:0046717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046717", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "branching morphogenesis of a nerve", "id": "GO:0048755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048755", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of protein secretion", "id": "GO:0050709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050709", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of dopamine uptake involved in synaptic transmission", "id": "GO:0051584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051584", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of dopamine uptake involved in synaptic transmission", "id": "GO:0051586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051586", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "phospholipase C-activating dopamine receptor signaling pathway", "id": "GO:0060158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060158", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of dopamine receptor signaling pathway", "id": "GO:0060160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060160", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of locomotion involved in locomotory behavior", "id": "GO:0090325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090325", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "startle response", "id": "GO:0001964", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001964", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "hyaloid vascular plexus regression", "id": "GO:1990384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990384", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "temperature homeostasis", "id": "GO:0001659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001659", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of adenylate cyclase activity", "id": "GO:0007194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007194", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "locomotory behavior", "id": "GO:0007626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007626", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "cell population proliferation", "id": "GO:0008283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "associative learning", "id": "GO:0008306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008306", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adult behavior", "id": "GO:0030534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030534", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "forebrain development", "id": "GO:0030900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030900", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to nicotine", "id": "GO:0035094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035094", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of G protein-coupled receptor signaling pathway", "id": "GO:0045745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045745", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of long-term neuronal synaptic plasticity", "id": "GO:0048169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048169", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adenylate cyclase-activating adrenergic receptor signaling pathway", "id": "GO:0071880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071880", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of long-term synaptic potentiation", "id": "GO:1900273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900273", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "neuron migration", "id": "GO:0001764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001764", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of protein phosphorylation", "id": "GO:0001933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to amphetamine", "id": "GO:0001975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001975", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of dopamine secretion", "id": "GO:0014059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014059", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of urine volume", "id": "GO:0035810", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035810", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of renal sodium excretion", "id": "GO:0035815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035815", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of blood pressure", "id": "GO:0045776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045776", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "behavioral response to ethanol", "id": "GO:0048149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048149", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "arachidonic acid secretion", "id": "GO:0050482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050482", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of epithelial cell proliferation", "id": "GO:0050680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050680", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of synaptic transmission, glutamatergic", "id": "GO:0051967", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051967", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "prepulse inhibition", "id": "GO:0060134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060134", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adenylate cyclase-modulating G protein-coupled receptor signaling pathway", "id": "GO:0007188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007188", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopamine receptor signaling pathway", "id": "GO:0007212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007212", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of sodium ion transport", "id": "GO:0002028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002028", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "synapse assembly", "id": "GO:0007416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007416", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "activation of protein kinase activity", "id": "GO:0032147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032147", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to morphine", "id": "GO:0043278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043278", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of insulin secretion", "id": "GO:0046676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046676", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "G protein-coupled receptor internalization", "id": "GO:0002031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002031", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adult walking behavior", "id": "GO:0007628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007628", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "feeding behavior", "id": "GO:0007631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007631", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to toxic substance", "id": "GO:0009636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009636", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to cocaine", "id": "GO:0042220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042220", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "drinking behavior", "id": "GO:0042756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042756", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "release of sequestered calcium ion into cytosol", "id": "GO:0051209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051209", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway", "id": "GO:0051482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051482", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "behavioral response to cocaine", "id": "GO:0048148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048148", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "modulation of chemical synaptic transmission", "id": "GO:0050804", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050804", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopamine metabolic process", "id": "GO:0042417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042417", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to axon injury", "id": "GO:0048678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048678", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "adenylate cyclase-inhibiting dopamine receptor signaling pathway", "id": "GO:0007195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007195", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "long-term memory", "id": "GO:0007616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007616", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of neuron migration", "id": "GO:2001223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001223", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of receptor internalization", "id": "GO:0002092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002092", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of synaptic transmission", "id": "GO:0050805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050805", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "protein kinase B signaling", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of heart rate", "id": "GO:0002027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002027", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of potassium ion transport", "id": "GO:0043266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043266", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of protein kinase B signaling", "id": "GO:0051898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051898", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "grooming behavior", "id": "GO:0007625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007625", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to iron ion", "id": "GO:0010039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010039", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of growth hormone secretion", "id": "GO:0060124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060124", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "neuron-neuron synaptic transmission", "id": "GO:0007270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007270", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "neuroblast proliferation", "id": "GO:0007405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007405", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "pigmentation", "id": "GO:0043473", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043473", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "orbitofrontal cortex development", "id": "GO:0021769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021769", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "cerebral cortex GABAergic interneuron migration", "id": "GO:0021853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021853", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of neuroblast proliferation", "id": "GO:0002052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002052", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "intracellular potassium ion homeostasis", "id": "GO:0030007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030007", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of multicellular organism growth", "id": "GO:0040018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040018", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of cytosolic calcium ion concentration", "id": "GO:0051481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051481", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "response to inactivity", "id": "GO:0014854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014854", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of cellular response to hypoxia", "id": "GO:1900038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900038", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of glial cell-derived neurotrophic factor production", "id": "GO:1900168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900168", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of voltage-gated calcium channel activity", "id": "GO:1901386", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901386", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of synapse structural plasticity", "id": "GO:0051823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051823", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of neurotransmitter uptake", "id": "GO:0051580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051580", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of cytokinesis", "id": "GO:0032467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032467", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "striatum development", "id": "GO:0021756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021756", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of MAPK cascade", "id": "GO:0043408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043408", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "positive regulation of neurogenesis", "id": "GO:0050769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050769", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of innate immune response", "id": "GO:0045824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045824", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "regulation of synaptic transmission, GABAergic", "id": "GO:0032228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032228", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "negative regulation of dopamine secretion", "id": "GO:0033602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033602", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "epithelial cell proliferation", "id": "GO:0050673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050673", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopamine uptake involved in synaptic transmission", "id": "GO:0051583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051583", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "postsynaptic modulation of chemical synaptic transmission", "id": "GO:0099170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099170", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "presynaptic modulation of chemical synaptic transmission", "id": "GO:0099171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099171", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 22, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "GABA-ergic synapse", "id": "GO:0098982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098982", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "cilium", "id": "GO:0005929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "axon terminus", "id": "GO:0043679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "postsynaptic membrane", "id": "GO:0045211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "acrosomal vesicle", "id": "GO:0001669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001669", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "sperm flagellum", "id": "GO:0036126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036126", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "lateral plasma membrane", "id": "GO:0016328", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016328", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "non-motile cilium", "id": "GO:0097730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097730", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "presynaptic membrane", "id": "GO:0042734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042734", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "ciliary membrane", "id": "GO:0060170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060170", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "presynapse", "id": "GO:0098793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopaminergic synapse", "id": "GO:0098691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098691", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "dopamine neurotransmitter receptor activity", "id": "GO:0004952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004952", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopamine neurotransmitter receptor activity, coupled via Gi/Go", "id": "GO:0001591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001591", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "ionotropic glutamate receptor binding", "id": "GO:0035255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035255", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "organic cyclic compound binding", "id": "GO:0097159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097159", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "dopamine binding", "id": "GO:0035240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035240", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" }, { "name": "heterocyclic compound binding", "id": "GO:1901363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901363", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 175, "end_pos": 177, "annotation": "n_glycosylation_sequon" }, { "start_pos": 17, "end_pos": 19, "annotation": "n_glycosylation_sequon" }, { "start_pos": 23, "end_pos": 25, "annotation": "n_glycosylation_sequon" }, { "start_pos": 243, "end_pos": 245, "annotation": "n_glycosylation_sequon" }, { "start_pos": 260, "end_pos": 262, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylated. Palmitoylation which is required for proper localization to the plasma membrane and stability of the receptor could be carried on by ZDHHC4, ZDHHC3 and ZDHHC8.", "evidence": [ { "database": "UniProtKB", "id": "P61169", "url": "https://www.uniprot.org/uniprot/P61169" }, { "database": "PubMed", "id": "P14416", "url": "https://glygen.org/publication/PubMed/P14416" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }