{
"uniprot_canonical_ac": "P61081-1",
"uniprot_ac": "P61081",
"uniprot_id": "UBC12_HUMAN",
"mass": {
"chemical_mass": 20900.0,
"monoisotopic_mass": 20900.0
},
"refseq": {
"ac": "NP_003960",
"name": "NEDD8-conjugating enzyme Ubc12",
"summary": "The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. [provided by RefSeq, Jul 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
},
"gene_names": [
{
"name": "UBE2M",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P61081",
"id": "P61081"
},
{
"name": "UBC12",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P61081",
"id": "P61081"
},
{
"name": "UBE2M",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960",
"id": "NP_003960"
},
{
"name": "hUbc12; UBC-RS2; UBC12",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960",
"id": "NP_003960"
}
],
"protein_names": [
{
"name": "NEDD8-conjugating enzyme Ubc12",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P61081"
},
{
"name": "2.3.2.34",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P61081"
},
{
"name": "NEDD8 carrier protein",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P61081"
},
{
"name": "NEDD8-conjugating enzyme Ubc12",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960",
"id": "NP_003960"
},
{
"name": "Ubiquitin-conjugating enzyme E2 M",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P61081"
},
{
"name": "ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); ubiquitin conjugating enzyme E2M; ubiquitin carrier protein M; yeast UBC12 homolog; ubiquitin-protein ligase M; NEDD8 protein ligase; NEDD8 carrier protein; epididymis secretory sperm binding protein",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960",
"id": "NP_003960"
}
],
"function": [
{
"annotation": "Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081#function"
},
{
"database": "PubMed",
"id": "10207026",
"url": "https://glygen.org/publication/PubMed/10207026"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"annotation": "NEDD8-conjugating enzyme UBC12 as a novel therapeutic target in esophageal squamous cell carcinoma. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
},
{
"database": "PubMed",
"id": "32651357",
"url": "https://glygen.org/publication/PubMed/32651357"
}
]
},
{
"annotation": "NPRL2 reduces the niraparib sensitivity of castration-resistant prostate cancer via interacting with UBE2M and enhancing neddylation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
},
{
"database": "PubMed",
"id": "33905671",
"url": "https://glygen.org/publication/PubMed/33905671"
}
]
},
{
"annotation": "The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. [provided by RefSeq, Jul 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
}
]
},
{
"annotation": "UBC12-mediated SREBP-1 neddylation worsens metastatic tumor prognosis.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
},
{
"database": "PubMed",
"id": "32449166",
"url": "https://glygen.org/publication/PubMed/32449166"
}
]
},
{
"annotation": "Ubiquitin conjugating enzyme E2 M promotes apoptosis in osteoarthritis chondrocytes via Wnt/beta-catenin signaling.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
},
{
"database": "PubMed",
"id": "32819607",
"url": "https://glygen.org/publication/PubMed/32819607"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [
{
"start_pos": 10,
"end_pos": 10,
"sequence_org": "Q",
"sequence_mut": "A",
"comment": "No effect on thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 111,
"end_pos": 111,
"sequence_org": "C",
"sequence_mut": "S",
"comment": "Forms a stable complex with NEDD8, which prevents subsequent NEDD8 conjugation to cullins.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "10828074",
"url": "https://glygen.org/publication/PubMed/10828074"
}
]
},
{
"start_pos": 11,
"end_pos": 11,
"sequence_org": "K",
"sequence_mut": "A",
"comment": "No effect on thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 12,
"end_pos": 12,
"sequence_org": "K",
"sequence_mut": "A",
"comment": "Impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 1,
"end_pos": 1,
"sequence_org": "M",
"sequence_mut": "A",
"comment": "No effect on thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 32,
"end_pos": 32,
"sequence_org": "L",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 35,
"end_pos": 35,
"sequence_org": "Q",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 36,
"end_pos": 36,
"sequence_org": "K",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 38,
"end_pos": 38,
"sequence_org": "I",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 39,
"end_pos": 39,
"sequence_org": "N",
"sequence_mut": "A",
"comment": "No effect on thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 41,
"end_pos": 41,
"sequence_org": "L",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 4,
"end_pos": 4,
"sequence_org": "L",
"sequence_mut": "A",
"comment": "Impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 51,
"end_pos": 51,
"sequence_org": "F",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 55,
"end_pos": 55,
"sequence_org": "D",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 57,
"end_pos": 57,
"sequence_org": "L",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"start_pos": 5,
"end_pos": 5,
"sequence_org": "F",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 6,
"end_pos": 6,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Slightly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 7,
"end_pos": 7,
"sequence_org": "L",
"sequence_mut": "A",
"comment": "Strongly impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"start_pos": 9,
"end_pos": 9,
"sequence_org": "Q",
"sequence_mut": "A",
"comment": "Impairs thioester intermediate formation.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "85.96",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "83.86",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "90.79",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "79.69",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "96.51",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "93.69",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "83.42",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "89.56",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "93.52",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "75.98",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "82.79",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "95.94",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "94.57",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P61081",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P61081"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "UBE2M",
"url": "https://www.uniprot.org/uniprot/P61081",
"locus": {
"chromosome": "19",
"start_pos": 58555712,
"end_pos": 58558954,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000130725",
"url": "https://www.ensembl.org/id/ENSG00000130725"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000130725",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000130725",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.3.2.34",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.2.34&UniProtAcc=P61081",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00195",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00195",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL4295787",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295787",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "UBE2M",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UBE2M",
"database": "GeneCards",
"categories": [
"Organism-specific",
"Gene Annotation"
]
},
{
"id": "9040",
"url": "https://www.ncbi.nlm.nih.gov/gene/9040",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "12491",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12491",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P61081",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P61081*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000608",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000608",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016135",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016135",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR023313",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR023313",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:9040",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9040",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "603173",
"url": "http://www.omim.org/entry/603173",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P61081",
"url": "https://www.nextprot.org/entry/NX_P61081",
"database": "neXtProt",
"categories": [
"Organism-specific",
"Protein"
]
},
{
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "GYPHDAP",
"url": "https://omabrowser.org/oma/group/GYPHDAP/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "46085at2759",
"url": "http://www.orthodb.org/?query=46085at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24067",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24067:SF261",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067:SF261",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24068",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24068:SF487",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068:SF487",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1TT5",
"url": "https://www.rcsb.org/structure/1TT5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1Y8X",
"url": "https://www.rcsb.org/structure/1Y8X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2NVU",
"url": "https://www.rcsb.org/structure/2NVU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3TDU",
"url": "https://www.rcsb.org/structure/3TDU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3TDZ",
"url": "https://www.rcsb.org/structure/3TDZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4GAO",
"url": "https://www.rcsb.org/structure/4GAO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4P5O",
"url": "https://www.rcsb.org/structure/4P5O",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00179",
"url": "http://pfam.xfam.org/family/PF00179",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P61081",
"url": "https://pharos.nih.gov/targets/P61081",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P61081",
"url": "http://purl.obolibrary.org/obo/PR_P61081",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5676590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "M0QX69",
"url": "https://www.uniprot.org/uniprot/M0QX69",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "M0QX69-1",
"url": "https://www.uniprot.org/uniprot/M0QX69-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "M0QYI6",
"url": "https://www.uniprot.org/uniprot/M0QYI6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "M0QYI6-1",
"url": "https://www.uniprot.org/uniprot/M0QYI6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P61081-1",
"url": "https://www.uniprot.org/uniprot/P61081-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK",
"length": 183,
"header": "sp|P61081-1|UBC12_HUMAN Isoform 1 of NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1 CANONICAL=P61081-1"
},
"isoforms": [
{
"isoform_ac": "M0QX69-1",
"url": "",
"sequence": {
"sequence": "MVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQR",
"length": 69,
"header": "tr|M0QX69-1|M0QX69_HUMAN Computationally mapped isoform of Ubiquitin conjugating enzyme E2 M OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=8 CANONICAL=P61081-1"
},
"locus": {
"chromosome": "19",
"start_pos": 58556742,
"end_pos": 58556143,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000595957.5",
"url": "https://www.ensembl.org/id/ENST00000595957.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000468940.1",
"url": "https://www.ensembl.org/id/ENSP00000468940.1"
}
]
}
},
{
"isoform_ac": "M0QYI6-1",
"url": "",
"sequence": {
"sequence": "FKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLVSRNRWLGLGRLAFCPSGLLTPPTCTGHRSPTPRTH",
"length": 114,
"header": "tr|M0QYI6-1|M0QYI6_HUMAN Computationally mapped isoform of Ubiquitin conjugating enzyme E2 M OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1 CANONICAL=P61081-1"
},
"locus": {
"chromosome": "19",
"start_pos": 58557089,
"end_pos": 58556208,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000596985.1",
"url": "https://www.ensembl.org/id/ENST00000596985.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000469855.1",
"url": "https://www.ensembl.org/id/ENSP00000469855.1"
}
]
}
},
{
"isoform_ac": "P61081-1",
"url": "",
"sequence": {
"sequence": "MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK",
"length": 183,
"header": "sp|P61081-1|UBC12_HUMAN Isoform 1 of NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1 CANONICAL=P61081-1"
},
"locus": {
"chromosome": "19",
"start_pos": 58558381,
"end_pos": 58556092,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000253023.8",
"url": "https://www.ensembl.org/id/ENST00000253023.8"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000253023.2",
"url": "https://www.ensembl.org/id/ENSP00000253023.2"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P61081",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
},
{
"id": "33214551",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/33214551"
},
{
"id": "35138101",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35138101"
},
{
"id": "34725712",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34725712"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "28510447",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28510447"
},
{
"id": "34229054",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34229054"
}
]
}
],
"phosphorylation": [
{
"start_pos": 20,
"end_pos": 20,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P61081",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61081"
},
{
"database": "PubMed",
"id": "20068230",
"url": "https://glygen.org/publication/PubMed/20068230"
}
],
"site_lbl": "Thr20"
},
{
"start_pos": 50,
"end_pos": 50,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "iPTMnet",
"id": "P61081",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61081"
},
{
"database": "phospho.ELM",
"id": "P61081",
"url": "http://phospho.elm.eu.org/byAccession/P61081.html"
}
],
"site_lbl": "Ser50"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Identification of the activating and conjugating enzymes of the NEDD8 conjugation pathway.",
"journal": "J. Biol. Chem.",
"date": "1999",
"authors": "Gong L, Yeh ET",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "10207026",
"url": "https://glygen.org/publication/PubMed/10207026"
}
]
},
{
"title": "Identification of the von Hippel-lindau tumor-suppressor protein as part of an active E3 ubiquitin ligase complex.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Iwai K, Yamanaka K, Kamura T, Minato N, Conaway RC, Conaway JW, Klausner RD, Pause A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "10535940",
"url": "https://glygen.org/publication/PubMed/10535940"
}
]
},
{
"title": "Covalent modification of all members of human cullin family proteins by NEDD8.",
"journal": "Oncogene",
"date": "1999",
"authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "10597293",
"url": "https://glygen.org/publication/PubMed/10597293"
}
]
},
{
"title": "A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.",
"journal": "The EMBO journal",
"date": "2000",
"authors": "Meyer HH, Shorter JG, Seemann J, Pappin D, Warren G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "10811609",
"url": "https://glygen.org/publication/PubMed/10811609"
}
]
},
{
"title": "A dominant-negative UBC12 mutant sequesters NEDD8 and inhibits NEDD8 conjugation in vivo.",
"journal": "J. Biol. Chem.",
"date": "2000",
"authors": "Wada H, Yeh ET, Kamitani T",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "10828074",
"url": "https://glygen.org/publication/PubMed/10828074"
}
]
},
{
"title": "Ubiquitination of hypoxia-inducible factor requires direct binding to the beta-domain of the von Hippel-Lindau protein.",
"journal": "Nature cell biology",
"date": "2000",
"authors": "Ohh M, Park CW, Ivan M, Hoffman MA, Kim TY, Huang LE, Pavletich N, Chau V, Kaelin WG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "10878807",
"url": "https://glygen.org/publication/PubMed/10878807"
}
]
},
{
"title": "Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Kamura T, Sato S, Iwai K, Czyzyk-Krzeska M, Conaway RC, Conaway JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "10973499",
"url": "https://glygen.org/publication/PubMed/10973499"
}
]
},
{
"title": "Two new proteases in the MHC class I processing pathway.",
"journal": "Nature immunology",
"date": "2000",
"authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "11062501",
"url": "https://glygen.org/publication/PubMed/11062501"
}
]
},
{
"title": "The ubiquitin-proteasome pathway regulates survivin degradation in a cell cycle-dependent manner.",
"journal": "Journal of cell science",
"date": "2000",
"authors": "Zhao J, Tenev T, Martins LM, Downward J, Lemoine NR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11069780",
"url": "https://glygen.org/publication/PubMed/11069780"
}
]
},
{
"title": "Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.",
"journal": "Methods in molecular biology (Clifton, N.J.)",
"date": "2001",
"authors": "Souchelnytskyi S, Ronnstrand L, Heldin CH, ten Dijke P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "11100470",
"url": "https://glygen.org/publication/PubMed/11100470"
}
]
},
{
"title": "Evidence that furin is an authentic transforming growth factor-beta1-converting enzyme.",
"journal": "The American journal of pathology",
"date": "2001",
"authors": "Dubois CM, Blanchette F, Laprise MH, Leduc R, Grondin F, Seidah NG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "11141505",
"url": "https://glygen.org/publication/PubMed/11141505"
}
]
},
{
"title": "NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Xiao G, Harhaj EW, Sun SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "11239468",
"url": "https://glygen.org/publication/PubMed/11239468"
}
]
},
{
"title": "NUB1, a NEDD8-interacting protein, is induced by interferon and down-regulates the NEDD8 expression.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Kito K, Yeh ET, Kamitani T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11259415",
"url": "https://glygen.org/publication/PubMed/11259415"
}
]
},
{
"title": "Targeting of HIF-alpha to the von Hippel-Lindau ubiquitylation complex by O2-regulated prolyl hydroxylation.",
"journal": "Science (New York, N.Y.)",
"date": "2001",
"authors": "Jaakkola P, Mole DR, Tian YM, Wilson MI, Gielbert J, Gaskell SJ, von Kriegsheim A, Hebestreit HF, Mukherji M, Schofield CJ, Maxwell PH, Pugh CW, Ratcliffe PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11292861",
"url": "https://glygen.org/publication/PubMed/11292861"
}
]
},
{
"title": "HIFalpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O2 sensing.",
"journal": "Science (New York, N.Y.)",
"date": "2001",
"authors": "Ivan M, Kondo K, Yang H, Kim W, Valiando J, Ohh M, Salic A, Asara JM, Lane WS, Kaelin WG Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11292862",
"url": "https://glygen.org/publication/PubMed/11292862"
}
]
},
{
"title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "11350924",
"url": "https://glygen.org/publication/PubMed/11350924"
}
]
},
{
"title": "Processing of immunosuppressive pro-TGF-beta 1,2 by human glioblastoma cells involves cytoplasmic and secreted furin-like proteases.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2001",
"authors": "Leitlein J, Aulwurm S, Waltereit R, Naumann U, Wagenknecht B, Garten W, Weller M, Platten M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "11390472",
"url": "https://glygen.org/publication/PubMed/11390472"
}
]
},
{
"title": "Hypoxia-inducible factor-1 alpha (HIF-1 alpha) escapes O(2)-driven proteasomal degradation irrespective of its subcellular localization: nucleus or cytoplasm.",
"journal": "EMBO reports",
"date": "2001",
"authors": "Berra E, Roux D, Richard DE, Pouyssegur J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11454738",
"url": "https://glygen.org/publication/PubMed/11454738"
}
]
},
{
"title": "Activation by IKKalpha of a second, evolutionary conserved, NF-kappa B signaling pathway.",
"journal": "Science (New York, N.Y.)",
"date": "2001",
"authors": "Senftleben U, Cao Y, Xiao G, Greten FR, Krahn G, Bonizzi G, Chen Y, Hu Y, Fong A, Sun SC, Karin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "11520989",
"url": "https://glygen.org/publication/PubMed/11520989"
}
]
},
{
"title": "Targeting of NEDD8 and its conjugates for proteasomal degradation by NUB1.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Kamitani T, Kito K, Fukuda-Kamitani T, Yeh ET",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11585840",
"url": "https://glygen.org/publication/PubMed/11585840"
}
]
},
{
"title": "Mobilization of processed, membrane-tethered SPT23 transcription factor by CDC48(UFD1/NPL4), a ubiquitin-selective chaperone.",
"journal": "Cell",
"date": "2001",
"authors": "Rape M, Hoppe T, Gorr I, Kalocay M, Richly H, Jentsch S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11733065",
"url": "https://glygen.org/publication/PubMed/11733065"
}
]
},
{
"title": "Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.",
"journal": "Nature",
"date": "2002",
"authors": "Zheng N, Schulman BA, Song L, Miller JJ, Jeffrey PD, Wang P, Chu C, Koepp DM, Elledge SJ, Pagano M, Conaway RC, Conaway JW, Harper JW, Pavletich NP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "11961546",
"url": "https://glygen.org/publication/PubMed/11961546"
}
]
},
{
"title": "Oxygen-dependent ubiquitination and degradation of hypoxia-inducible factor requires nuclear-cytoplasmic trafficking of the von Hippel-Lindau tumor suppressor protein.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Groulx I, Lee S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12101228",
"url": "https://glygen.org/publication/PubMed/12101228"
}
]
},
{
"title": "Analysis of the adenovirus E1B-55K-anchored proteome reveals its link to ubiquitination machinery.",
"journal": "Journal of virology",
"date": "2002",
"authors": "Harada JN, Shevchenko A, Shevchenko A, Pallas DC, Berk AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12186903",
"url": "https://glygen.org/publication/PubMed/12186903"
}
]
},
{
"title": "Making sense of latent TGFbeta activation.",
"journal": "Journal of cell science",
"date": "2003",
"authors": "Annes JP, Munger JS, Rifkin DB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "12482908",
"url": "https://glygen.org/publication/PubMed/12482908"
}
]
},
{
"title": "NEDD8 modification of CUL1 dissociates p120(CAND1), an inhibitor of CUL1-SKP1 binding and SCF ligases.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Liu J, Furukawa M, Matsumoto T, Xiong Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12504025",
"url": "https://glygen.org/publication/PubMed/12504025"
}
]
},
{
"title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12504026",
"url": "https://glygen.org/publication/PubMed/12504026"
}
]
},
{
"title": "Parc: a cytoplasmic anchor for p53.",
"journal": "Cell",
"date": "2003",
"authors": "Nikolaev AY, Li M, Puskas N, Qin J, Gu W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12526791",
"url": "https://glygen.org/publication/PubMed/12526791"
}
]
},
{
"title": "Multiple splice variants of the human HIF-3 alpha locus are targets of the von Hippel-Lindau E3 ubiquitin ligase complex.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Maynard MA, Qi H, Chung J, Lee EH, Kondo Y, Hara S, Conaway RC, Conaway JW, Ohh M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12538644",
"url": "https://glygen.org/publication/PubMed/12538644"
}
]
},
{
"title": "TIP120A associates with cullins and modulates ubiquitin ligase activity.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Min KW, Hwang JW, Lee JS, Park Y, Tamura TA, Yoon JB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12609982",
"url": "https://glygen.org/publication/PubMed/12609982"
}
]
},
{
"title": "U-box proteins as a new family of ubiquitin ligases.",
"journal": "Biochemical and biophysical research communications",
"date": "2003",
"authors": "Hatakeyama S, Nakayama KI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "12646216",
"url": "https://glygen.org/publication/PubMed/12646216"
}
]
},
{
"title": "Keap1-dependent proteasomal degradation of transcription factor Nrf2 contributes to the negative regulation of antioxidant response element-driven gene expression.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "McMahon M, Itoh K, Yamamoto M, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12682069",
"url": "https://glygen.org/publication/PubMed/12682069"
}
]
},
{
"title": "DEN1 is a dual function protease capable of processing the C terminus of Nedd8 and deconjugating hyper-neddylated CUL1.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Wu K, Yamoah K, Dolios G, Gan-Erdene T, Tan P, Chen A, Lee CG, Wei N, Wilkinson KD, Wang R, Pan ZQ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12759363",
"url": "https://glygen.org/publication/PubMed/12759363"
}
]
},
{
"title": "Regulation of the NEDD8 conjugation system by a splicing variant, NUB1L.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Tanaka T, Kawashima H, Yeh ET, Kamitani T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "12816948",
"url": "https://glygen.org/publication/PubMed/12816948"
}
]
},
{
"title": "TGF beta signals through a heteromeric protein kinase receptor complex.",
"journal": "Cell",
"date": "1992",
"authors": "Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF, Massague J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "1333888",
"url": "https://glygen.org/publication/PubMed/1333888"
}
]
},
{
"title": "Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase.",
"journal": "Oncogene",
"date": "2004",
"authors": "Amir RE, Haecker H, Karin M, Ciechanover A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "14676825",
"url": "https://glygen.org/publication/PubMed/14676825"
}
]
},
{
"title": "The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.",
"journal": "Molecular cell",
"date": "2003",
"authors": "Walden H, Podgorski MS, Huang DT, Miller DW, Howard RJ, Minor DL Jr, Holton JM, Schulman BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "14690597",
"url": "https://glygen.org/publication/PubMed/14690597"
}
]
},
{
"title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.",
"journal": "Current opinion in immunology",
"date": "2004",
"authors": "Kloetzel PM, Ossendorp F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "14734113",
"url": "https://glygen.org/publication/PubMed/14734113"
}
]
},
{
"title": "NEDD8 ultimate buster-1L interacts with the ubiquitin-like protein FAT10 and accelerates its degradation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Hipp MS, Raasi S, Groettrup M, Schmidtke G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "14757770",
"url": "https://glygen.org/publication/PubMed/14757770"
}
]
},
{
"title": "Induction of p100 processing by NF-kappaB-inducing kinase involves docking IkappaB kinase alpha (IKKalpha) to p100 and IKKalpha-mediated phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Xiao G, Fong A, Sun SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "15140882",
"url": "https://glygen.org/publication/PubMed/15140882"
}
]
},
{
"title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.",
"journal": "Nature immunology",
"date": "2004",
"authors": "Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15224091",
"url": "https://glygen.org/publication/PubMed/15224091"
}
]
},
{
"title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.",
"journal": "Nature immunology",
"date": "2004",
"authors": "Rock KL, York IA, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15224092",
"url": "https://glygen.org/publication/PubMed/15224092"
}
]
},
{
"title": "Oxidative stress sensor Keap1 functions as an adaptor for Cul3-based E3 ligase to regulate proteasomal degradation of Nrf2.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Kobayashi A, Kang MI, Okawa H, Ohtsuji M, Zenke Y, Chiba T, Igarashi K, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15282312",
"url": "https://glygen.org/publication/PubMed/15282312"
}
]
},
{
"title": "The SCF ubiquitin ligase: insights into a molecular machine.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2004",
"authors": "Cardozo T, Pagano M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "15340381",
"url": "https://glygen.org/publication/PubMed/15340381"
}
]
},
{
"title": "Structural basis of heteromeric smad protein assembly in TGF-beta signaling.",
"journal": "Molecular cell",
"date": "2004",
"authors": "Chacko BM, Qin BY, Tiwari A, Shi G, Lam S, Hayward LJ, De Caestecker M, Lin K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "15350224",
"url": "https://glygen.org/publication/PubMed/15350224"
}
]
},
{
"title": "A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.",
"journal": "Nat. Struct. Mol. Biol.",
"date": "2004",
"authors": "Huang DT, Miller DW, Mathew R, Cassell R, Holton JM, Roussel MF, Schulman BA",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15361859",
"url": "https://glygen.org/publication/PubMed/15361859"
}
]
},
{
"title": "The Keap1-BTB protein is an adaptor that bridges Nrf2 to a Cul3-based E3 ligase: oxidative stress sensing by a Cul3-Keap1 ligase.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Cullinan SB, Gordan JD, Jin J, Harper JW, Diehl JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15367669",
"url": "https://glygen.org/publication/PubMed/15367669"
}
]
},
{
"title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.",
"journal": "Cell",
"date": "2004",
"authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15537541",
"url": "https://glygen.org/publication/PubMed/15537541"
}
]
},
{
"title": "TGF-beta activation by traction?",
"journal": "Trends in cell biology",
"date": "2004",
"authors": "Keski-Oja J, Koli K, von Melchner H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "15564041",
"url": "https://glygen.org/publication/PubMed/15564041"
}
]
},
{
"title": "The proteasome and MHC class I antigen processing.",
"journal": "Biochimica et biophysica acta",
"date": "2004",
"authors": "Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "15571818",
"url": "https://glygen.org/publication/PubMed/15571818"
}
]
},
{
"title": "Keap1 is a redox-regulated substrate adaptor protein for a Cul3-dependent ubiquitin ligase complex.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Zhang DD, Lo SC, Cross JV, Templeton DJ, Hannink M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15572695",
"url": "https://glygen.org/publication/PubMed/15572695"
}
]
},
{
"title": "Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.",
"journal": "Genes & development",
"date": "2004",
"authors": "Mehle A, Goncalves J, Santa-Marta M, McPike M, Gabuzda D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15574592",
"url": "https://glygen.org/publication/PubMed/15574592"
}
]
},
{
"title": "BTB protein Keap1 targets antioxidant transcription factor Nrf2 for ubiquitination by the Cullin 3-Roc1 ligase.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Furukawa M, Xiong Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15601839",
"url": "https://glygen.org/publication/PubMed/15601839"
}
]
},
{
"title": "A series of ubiquitin binding factors connects CDC48/p97 to substrate multiubiquitylation and proteasomal targeting.",
"journal": "Cell",
"date": "2005",
"authors": "Richly H, Rape M, Braun S, Rumpf S, Hoege C, Jentsch S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15652483",
"url": "https://glygen.org/publication/PubMed/15652483"
}
]
},
{
"title": "Function and regulation of cullin-RING ubiquitin ligases.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2005",
"authors": "Petroski MD, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15688063",
"url": "https://glygen.org/publication/PubMed/15688063"
}
]
},
{
"title": "Structural basis for recruitment of Ubc12 by an E2 binding domain in NEDD8's E1.",
"journal": "Mol. Cell",
"date": "2005",
"authors": "Huang DT, Paydar A, Zhuang M, Waddell MB, Holton JM, Schulman BA",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15694336",
"url": "https://glygen.org/publication/PubMed/15694336"
}
]
},
{
"title": "COMMD proteins, a novel family of structural and functional homologs of MURR1.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Burstein E, Hoberg JE, Wilkinson AS, Rumble JM, Csomos RA, Komarck CM, Maine GN, Wilkinson JC, Mayo MW, Duckett CS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "15799966",
"url": "https://glygen.org/publication/PubMed/15799966"
}
]
},
{
"title": "Interaction of NUB1 with the proteasome subunit S5a.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Tanji K, Tanaka T, Kamitani T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16171779",
"url": "https://glygen.org/publication/PubMed/16171779"
}
]
},
{
"title": "beta-TrCP binding and processing of NF-kappaB2/p100 involve its phosphorylation at serines 866 and 870.",
"journal": "Cellular signalling",
"date": "2006",
"authors": "Liang C, Zhang M, Sun SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "16303288",
"url": "https://glygen.org/publication/PubMed/16303288"
}
]
},
{
"title": "Targeted silencing of Jab1/Csn5 in human cells downregulates SCF activity through reduction of F-box protein levels.",
"journal": "BMC biochemistry",
"date": "2006",
"authors": "Cope GA, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16401342",
"url": "https://glygen.org/publication/PubMed/16401342"
}
]
},
{
"title": "Cytoplasmic localized ubiquitin ligase cullin 7 binds to p53 and promotes cell growth by antagonizing p53 function.",
"journal": "Oncogene",
"date": "2006",
"authors": "Andrews P, He YJ, Xiong Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16547496",
"url": "https://glygen.org/publication/PubMed/16547496"
}
]
},
{
"title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Tokgoz Z, Bohnsack RN, Haas AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16595681",
"url": "https://glygen.org/publication/PubMed/16595681"
}
]
},
{
"title": "Ubiquitin and SUMO systems in the regulation of mitotic checkpoints.",
"journal": "Trends in biochemical sciences",
"date": "2006",
"authors": "Gutierrez GJ, Ronai Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16647857",
"url": "https://glygen.org/publication/PubMed/16647857"
}
]
},
{
"title": "The UBA domains of NUB1L are required for binding but not for accelerated degradation of the ubiquitin-like modifier FAT10.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Schmidtke G, Kalveram B, Weber E, Bochtler P, Lukasiak S, Hipp MS, Groettrup M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16707496",
"url": "https://glygen.org/publication/PubMed/16707496"
}
]
},
{
"title": "Dimerization of substrate adaptors can facilitate cullin-mediated ubiquitylation of proteins by a `tethering` mechanism: a two-site interaction model for the Nrf2-Keap1 complex.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "McMahon M, Thomas N, Itoh K, Yamamoto M, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16790436",
"url": "https://glygen.org/publication/PubMed/16790436"
}
]
},
{
"title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2006",
"authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16849449",
"url": "https://glygen.org/publication/PubMed/16849449"
}
]
},
{
"title": "The COP9 signalosome regulates Skp2 levels and proliferation of human cells.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Denti S, Fernandez-Sanchez ME, Rogge L, Bianchi E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "16943200",
"url": "https://glygen.org/publication/PubMed/16943200"
}
]
},
{
"title": "A novel family of membrane-bound E3 ubiquitin ligases.",
"journal": "Journal of biochemistry",
"date": "2006",
"authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "16954532",
"url": "https://glygen.org/publication/PubMed/16954532"
}
]
},
{
"title": "Regulation and function of IKK and IKK-related kinases.",
"journal": "Science's STKE : signal transduction knowledge environment",
"date": "2006",
"authors": "Hacker H, Karin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "17047224",
"url": "https://glygen.org/publication/PubMed/17047224"
}
]
},
{
"title": "Two-site substrate recognition model for the Keap1-Nrf2 system: a hinge and latch mechanism.",
"journal": "Biological chemistry",
"date": "2006",
"authors": "Tong KI, Kobayashi A, Katsuoka F, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17081101",
"url": "https://glygen.org/publication/PubMed/17081101"
}
]
},
{
"title": "Role of the NEDD8 modification of Cul2 in the sequential activation of ECV complex.",
"journal": "Neoplasia (New York, N.Y.)",
"date": "2006",
"authors": "Sufan RI, Ohh M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17132228",
"url": "https://glygen.org/publication/PubMed/17132228"
}
]
},
{
"title": "COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.",
"journal": "The EMBO journal",
"date": "2007",
"authors": "Maine GN, Mao X, Komarck CM, Burstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17183367",
"url": "https://glygen.org/publication/PubMed/17183367"
}
]
},
{
"title": "Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.",
"journal": "Nature",
"date": "2007",
"authors": "Huang DT, Hunt HW, Zhuang M, Ohi MD, Holton JM, Schulman BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17220875",
"url": "https://glygen.org/publication/PubMed/17220875"
}
]
},
{
"title": "PARC and CUL7 form atypical cullin RING ligase complexes.",
"journal": "Cancer research",
"date": "2007",
"authors": "Skaar JR, Florens L, Tsutsumi T, Arai T, Tron A, Swanson SK, Washburn MP, DeCaprio JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17332328",
"url": "https://glygen.org/publication/PubMed/17332328"
}
]
},
{
"title": "COMMD proteins: COMMing to the scene.",
"journal": "Cellular and molecular life sciences : CMLS",
"date": "2007",
"authors": "Maine GN, Burstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17497243",
"url": "https://glygen.org/publication/PubMed/17497243"
}
]
},
{
"title": "Different electrostatic potentials define ETGE and DLG motifs as hinge and latch in oxidative stress response.",
"journal": "Molecular and cellular biology",
"date": "2007",
"authors": "Tong KI, Padmanabhan B, Kobayashi A, Shang C, Hirotsu Y, Yokoyama S, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "17785452",
"url": "https://glygen.org/publication/PubMed/17785452"
}
]
},
{
"title": "Downregulation of COP9 signalosome subunits differentially affects the CSN complex and target protein stability.",
"journal": "BMC biochemistry",
"date": "2007",
"authors": "Peth A, Berndt C, Henke W, Dubiel W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18093314",
"url": "https://glygen.org/publication/PubMed/18093314"
}
]
},
{
"title": "Dcn1 functions as a scaffold-type E3 ligase for cullin neddylation.",
"journal": "Molecular cell",
"date": "2008",
"authors": "Kurz T, Chou YC, Willems AR, Meyer-Schaller N, Hecht ML, Tyers M, Peter M, Sicheri F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18206966",
"url": "https://glygen.org/publication/PubMed/18206966"
}
]
},
{
"title": "The type I TGF-beta receptor is covalently modified and regulated by sumoylation.",
"journal": "Nature cell biology",
"date": "2008",
"authors": "Kang JS, Saunier EF, Akhurst RJ, Derynck R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "18469808",
"url": "https://glygen.org/publication/PubMed/18469808"
}
]
},
{
"title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.",
"journal": "Cell",
"date": "2008",
"authors": "Lee I, Schindelin H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18662542",
"url": "https://glygen.org/publication/PubMed/18662542"
}
]
},
{
"title": "A quantitative atlas of mitotic phosphorylation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "iPTMnet",
"id": "P61081",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
}
]
},
{
"title": "UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.",
"journal": "Cell",
"date": "2008",
"authors": "Alexandru G, Graumann J, Smith GT, Kolawa NJ, Fang R, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18775313",
"url": "https://glygen.org/publication/PubMed/18775313"
}
]
},
{
"title": "Comparative analysis of mRNA targets for human PUF-family proteins suggests extensive interaction with the miRNA regulatory system.",
"journal": "PloS one",
"date": "2008",
"authors": "Galgano A, Forrer M, Jaskiewicz L, Kanitz A, Zavolan M, Gerber AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18776931",
"url": "https://glygen.org/publication/PubMed/18776931"
}
]
},
{
"title": "Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.",
"journal": "Cell",
"date": "2008",
"authors": "Duda DM, Borg LA, Scott DC, Hunt HW, Hammel M, Schulman BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18805092",
"url": "https://glygen.org/publication/PubMed/18805092"
}
]
},
{
"title": "SCCRO (DCUN1D1) is an essential component of the E3 complex for neddylation.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Kim AY, Bommelje CC, Lee BE, Yonekawa Y, Choi L, Morris LG, Huang G, Kaufman A, Ryan RJ, Hao B, Ramanathan Y, Singh B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18826954",
"url": "https://glygen.org/publication/PubMed/18826954"
}
]
},
{
"title": "Multimodal activation of the ubiquitin ligase SCF by Nedd8 conjugation.",
"journal": "Molecular cell",
"date": "2008",
"authors": "Saha A, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18851830",
"url": "https://glygen.org/publication/PubMed/18851830"
}
]
},
{
"title": "The COP9 signalosome: more than a protease.",
"journal": "Trends in biochemical sciences",
"date": "2008",
"authors": "Wei N, Serino G, Deng XW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "18926707",
"url": "https://glygen.org/publication/PubMed/18926707"
}
]
},
{
"title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.",
"journal": "The international journal of biochemistry & cell biology",
"date": "2009",
"authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19028597",
"url": "https://glygen.org/publication/PubMed/19028597"
}
]
},
{
"title": "Dectin-1 directs T helper cell differentiation by controlling noncanonical NF-kappaB activation through Raf-1 and Syk.",
"journal": "Nature immunology",
"date": "2009",
"authors": "Gringhuis SI, den Dunnen J, Litjens M, van der Vlist M, Wevers B, Bruijns SC, Geijtenbeek TB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "19122653",
"url": "https://glygen.org/publication/PubMed/19122653"
}
]
},
{
"title": "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.",
"journal": "Mol. Cell",
"date": "2009",
"authors": "Huang DT, Ayrault O, Hunt HW, Taherbhoy AM, Duda DM, Scott DC, Borg LA, Neale G, Murray PJ, Roussel MF, Schulman BA",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "19250909",
"url": "https://glygen.org/publication/PubMed/19250909"
}
]
},
{
"title": "NRF2 and KEAP1 mutations: permanent activation of an adaptive response in cancer.",
"journal": "Trends in biochemical sciences",
"date": "2009",
"authors": "Hayes JD, McMahon M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "19321346",
"url": "https://glygen.org/publication/PubMed/19321346"
}
]
},
{
"title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2009",
"authors": "Schulman BA, Harper JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19352404",
"url": "https://glygen.org/publication/PubMed/19352404"
}
]
},
{
"title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?",
"journal": "Journal of molecular evolution",
"date": "2009",
"authors": "Michelle C, Vourc'h P, Mignon L, Andres CR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19452197",
"url": "https://glygen.org/publication/PubMed/19452197"
}
]
},
{
"title": "RING domain E3 ubiquitin ligases.",
"journal": "Annual review of biochemistry",
"date": "2009",
"authors": "Deshaies RJ, Joazeiro CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19489725",
"url": "https://glygen.org/publication/PubMed/19489725"
}
]
},
{
"title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.",
"journal": "Science",
"date": "2009",
"authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "19608861",
"url": "https://glygen.org/publication/PubMed/19608861"
}
]
},
{
"title": "The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009",
"authors": "Meyer-Schaller N, Chou YC, Sumara I, Martin DD, Kurz T, Katheder N, Hofmann K, Berthiaume LG, Sicheri F, Peter M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "19617556",
"url": "https://glygen.org/publication/PubMed/19617556"
}
]
},
{
"title": "Single-molecule imaging reveals transforming growth factor-beta-induced type II receptor dimerization.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009",
"authors": "Zhang W, Jiang Y, Wang Q, Ma X, Xiao Z, Zuo W, Fang X, Chen YG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "19720988",
"url": "https://glygen.org/publication/PubMed/19720988"
}
]
},
{
"title": "F-box-directed CRL complex assembly and regulation by the CSN and CAND1.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Schmidt MW, McQuary PR, Wee S, Hofmann K, Wolf DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "19748355",
"url": "https://glygen.org/publication/PubMed/19748355"
}
]
},
{
"title": "Building ubiquitin chains: E2 enzymes at work.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2009",
"authors": "Ye Y, Rape M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19851334",
"url": "https://glygen.org/publication/PubMed/19851334"
}
]
},
{
"title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.",
"journal": "Journal of biology",
"date": "2009",
"authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19874575",
"url": "https://glygen.org/publication/PubMed/19874575"
}
]
},
{
"title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2010",
"authors": "van Wijk SJ, Timmers HT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "19940261",
"url": "https://glygen.org/publication/PubMed/19940261"
}
]
},
{
"title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW",
"evidence": [
{
"database": "iPTMnet",
"id": "P61081",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068230",
"url": "https://glygen.org/publication/PubMed/20068230"
}
]
},
{
"title": "Controlling the fate of NIK: a central stage in noncanonical NF-kappaB signaling.",
"journal": "Science signaling",
"date": "2010",
"authors": "Sun SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "20501935",
"url": "https://glygen.org/publication/PubMed/20501935"
}
]
},
{
"title": "Monomeric type I and type III transforming growth factor-beta receptors and their dimerization revealed by single-molecule imaging.",
"journal": "Cell research",
"date": "2010",
"authors": "Zhang W, Yuan J, Yang Y, Xu L, Wang Q, Zuo W, Fang X, Chen YG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "20625381",
"url": "https://glygen.org/publication/PubMed/20625381"
}
]
},
{
"title": "Temporal and spatial regulation of targeting aurora B to the inner centromere.",
"journal": "Cold Spring Harbor symposia on quantitative biology",
"date": "2010",
"authors": "Watanabe Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "21447816",
"url": "https://glygen.org/publication/PubMed/21447816"
}
]
},
{
"title": "Neddylation-induced conformational control regulates cullin RING ligase activity in vivo.",
"journal": "Journal of molecular biology",
"date": "2011",
"authors": "Boh BK, Smith PG, Hagen T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "21463634",
"url": "https://glygen.org/publication/PubMed/21463634"
}
]
},
{
"title": "COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Mao X, Gluck N, Chen B, Starokadomskyy P, Li H, Maine GN, Burstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "21778237",
"url": "https://glygen.org/publication/PubMed/21778237"
}
]
},
{
"title": "RINGs of good and evil: RING finger ubiquitin ligases at the crossroads of tumour suppression and oncogenesis.",
"journal": "Nature reviews. Cancer",
"date": "2011",
"authors": "Lipkowitz S, Weissman AM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "21863050",
"url": "https://glygen.org/publication/PubMed/21863050"
}
]
},
{
"title": "N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.",
"journal": "Science",
"date": "2011",
"authors": "Scott DC, Monda JK, Bennett EJ, Harper JW, Schulman BA",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "21940857",
"url": "https://glygen.org/publication/PubMed/21940857"
}
]
},
{
"title": "Inhibition of NEDD8-conjugation pathway by novel molecules: potential approaches to anticancer therapy.",
"journal": "Molecular oncology",
"date": "2012",
"authors": "Tanaka T, Nakatani T, Kamitani T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "22306028",
"url": "https://glygen.org/publication/PubMed/22306028"
}
]
},
{
"title": "NEDD8 links cullin-RING ubiquitin ligase function to the p97 pathway.",
"journal": "Nature structural & molecular biology",
"date": "2012",
"authors": "den Besten W, Verma R, Kleiger G, Oania RS, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "22466964",
"url": "https://glygen.org/publication/PubMed/22466964"
}
]
},
{
"title": "UBXN7 docks on neddylated cullin complexes using its UIM motif and causes HIF1alpha accumulation.",
"journal": "BMC biology",
"date": "2012",
"authors": "Bandau S, Knebel A, Gage ZO, Wood NT, Alexandru G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "22537386",
"url": "https://glygen.org/publication/PubMed/22537386"
}
]
},
{
"title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "2261476",
"url": "https://glygen.org/publication/PubMed/2261476"
}
]
},
{
"title": "Structure of the nuclear factor kappaB-inducing kinase (NIK) kinase domain reveals a constitutively active conformation.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Liu J, Sudom A, Min X, Cao Z, Gao X, Ayres M, Lee F, Cao P, Johnstone S, Plotnikova O, Walker N, Chen G, Wang Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "22718757",
"url": "https://glygen.org/publication/PubMed/22718757"
}
]
},
{
"title": "Structural basis for a reciprocal regulation between SCF and CSN.",
"journal": "Cell reports",
"date": "2012",
"authors": "Enchev RI, Scott DC, da Fonseca PC, Schreiber A, Monda JK, Schulman BA, Peter M, Morris EP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "22959436",
"url": "https://glygen.org/publication/PubMed/22959436"
}
]
},
{
"title": "Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.",
"journal": "Structure",
"date": "2013",
"authors": "Monda JK, Scott DC, Miller DJ, Lydeard J, King D, Harper JW, Bennett EJ, Schulman BA",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23201271",
"url": "https://glygen.org/publication/PubMed/23201271"
}
]
},
{
"title": "c-Cbl-mediated neddylation antagonizes ubiquitination and degradation of the TGF-beta type II receptor.",
"journal": "Molecular cell",
"date": "2013",
"authors": "Zuo W, Huang F, Chiang YJ, Li M, Du J, Ding Y, Zhang T, Lee HW, Jeong LS, Chen Y, Deng H, Feng XH, Luo S, Gao C, Chen YG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "23290524",
"url": "https://glygen.org/publication/PubMed/23290524"
}
]
},
{
"title": "FAT10ylation as a signal for proteasomal degradation.",
"journal": "Biochimica et biophysica acta",
"date": "2014",
"authors": "Schmidtke G, Aichem A, Groettrup M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23333871",
"url": "https://glygen.org/publication/PubMed/23333871"
}
]
},
{
"title": "DCNL1 functions as a substrate sensor and activator of cullin 2-RING ligase.",
"journal": "Molecular and cellular biology",
"date": "2013",
"authors": "Heir P, Sufan RI, Greer SN, Poon BP, Lee JE, Ohh M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23401859",
"url": "https://glygen.org/publication/PubMed/23401859"
}
]
},
{
"title": "Cand1 promotes assembly of new SCF complexes through dynamic exchange of F box proteins.",
"journal": "Cell",
"date": "2013",
"authors": "Pierce NW, Lee JE, Liu X, Sweredoski MJ, Graham RL, Larimore EA, Rome M, Zheng N, Clurman BE, Hess S, Shan SO, Deshaies RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23453757",
"url": "https://glygen.org/publication/PubMed/23453757"
}
]
},
{
"title": "CSN- and CAND1-dependent remodelling of the budding yeast SCF complex.",
"journal": "Nature communications",
"date": "2013",
"authors": "Zemla A, Thomas Y, Kedziora S, Knebel A, Wood NT, Rabut G, Kurz T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23535662",
"url": "https://glygen.org/publication/PubMed/23535662"
}
]
},
{
"title": "CAND1 controls in vivo dynamics of the cullin 1-RING ubiquitin ligase repertoire.",
"journal": "Nature communications",
"date": "2013",
"authors": "Wu S, Zhu W, Nhan T, Toth JI, Petroski MD, Wolf DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23535663",
"url": "https://glygen.org/publication/PubMed/23535663"
}
]
},
{
"title": "CCDC22 deficiency in humans blunts activation of proinflammatory NF-kappaB signaling.",
"journal": "The Journal of clinical investigation",
"date": "2013",
"authors": "Starokadomskyy P, Gluck N, Li H, Chen B, Wallis M, Maine GN, Mao X, Zaidi IW, Hein MY, McDonald FJ, Lenzner S, Zecha A, Ropers HH, Kuss AW, McGaughran J, Gecz J, Burstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23563313",
"url": "https://glygen.org/publication/PubMed/23563313"
}
]
},
{
"title": "Deregulation of the COP9 signalosome-cullin-RING ubiquitin-ligase pathway: mechanisms and roles in urological cancers.",
"journal": "The international journal of biochemistry & cell biology",
"date": "2013",
"authors": "Gummlich L, Rabien A, Jung K, Dubiel W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23583660",
"url": "https://glygen.org/publication/PubMed/23583660"
}
]
},
{
"title": "The emerging family of CULLIN3-RING ubiquitin ligases (CRL3s): cellular functions and disease implications.",
"journal": "The EMBO journal",
"date": "2013",
"authors": "Genschik P, Sumara I, Lechner E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23912815",
"url": "https://glygen.org/publication/PubMed/23912815"
}
]
},
{
"title": "Regulatory flexibility in the Nrf2-mediated stress response is conferred by conformational cycling of the Keap1-Nrf2 protein complex.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2013",
"authors": "Baird L, Lleres D, Swift S, Dinkova-Kostova AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "23986495",
"url": "https://glygen.org/publication/PubMed/23986495"
}
]
},
{
"title": "TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.",
"journal": "The EMBO journal",
"date": "2013",
"authors": "Kelsall IR, Duda DM, Olszewski JL, Hofmann K, Knebel A, Langevin F, Wood N, Wightman M, Schulman BA, Alpi AF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "24076655",
"url": "https://glygen.org/publication/PubMed/24076655"
}
]
},
{
"title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.",
"journal": "Mol. Cell. Proteomics",
"date": "2014",
"authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "24129315",
"url": "https://glygen.org/publication/PubMed/24129315"
}
]
},
{
"title": "Oncogenic function of SCCRO5/DCUN1D5 requires its Neddylation E3 activity and nuclear localization.",
"journal": "Clin. Cancer Res.",
"date": "2014",
"authors": "Bommelje CC, Weeda VB, Huang G, Shah K, Bains S, Buss E, Shaha M, Gonen M, Ghossein R, Ramanathan SY, Singh B",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "24192928",
"url": "https://glygen.org/publication/PubMed/24192928"
}
]
},
{
"title": "Kinetic, thermodynamic, and structural characterizations of the association between Nrf2-DLGex degron and Keap1.",
"journal": "Molecular and cellular biology",
"date": "2014",
"authors": "Fukutomi T, Takagi K, Mizushima T, Ohuchi N, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "24366543",
"url": "https://glygen.org/publication/PubMed/24366543"
}
]
},
{
"title": "Hrd1 suppresses Nrf2-mediated cellular protection during liver cirrhosis.",
"journal": "Genes & development",
"date": "2014",
"authors": "Wu T, Zhao F, Gao B, Tan C, Yagishita N, Nakajima T, Wong PK, Chapman E, Fang D, Zhang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "24636985",
"url": "https://glygen.org/publication/PubMed/24636985"
}
]
},
{
"title": "The 3M complex maintains microtubule and genome integrity.",
"journal": "Molecular cell",
"date": "2014",
"authors": "Yan J, Yan F, Li Z, Sinnott B, Cappell KM, Yu Y, Mo J, Duncan JA, Chen X, Cormier-Daire V, Whitehurst AW, Xiong Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "24793695",
"url": "https://glygen.org/publication/PubMed/24793695"
}
]
},
{
"title": "CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.",
"journal": "Molecular cell",
"date": "2014",
"authors": "Li Z, Pei XH, Yan J, Yan F, Cappell KM, Whitehurst AW, Xiong Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "24793696",
"url": "https://glygen.org/publication/PubMed/24793696"
}
]
},
{
"title": "Cullin E3 ligases and their rewiring by viral factors.",
"journal": "Biomolecules",
"date": "2014",
"authors": "Mahon C, Krogan NJ, Craik CS, Pick E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "25314029",
"url": "https://glygen.org/publication/PubMed/25314029"
}
]
},
{
"title": "SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Huang G, Stock C, Bommelje CC, Weeda VB, Shah K, Bains S, Buss E, Shaha M, Rechler W, Ramanathan SY, Singh B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "25349211",
"url": "https://glygen.org/publication/PubMed/25349211"
}
]
},
{
"title": "COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.",
"journal": "Molecular biology of the cell",
"date": "2015",
"authors": "Phillips-Krawczak CA, Singla A, Starokadomskyy P, Deng Z, Osborne DG, Li H, Dick CJ, Gomez TS, Koenecke M, Zhang JS, Dai H, Sifuentes-Dominguez LF, Geng LN, Kaufmann SH, Hein MY, Wallis M, McGaughran J, Gecz J, Sluis Bv, Billadeau DD, Burstein E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "25355947",
"url": "https://glygen.org/publication/PubMed/25355947"
}
]
},
{
"title": "Protein neddylation: beyond cullin-RING ligases.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2015",
"authors": "Enchev RI, Schulman BA, Peter M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "25531226",
"url": "https://glygen.org/publication/PubMed/25531226"
}
]
},
{
"title": "Distinct and overlapping functions of the cullin E3 ligase scaffolding proteins CUL4A and CUL4B.",
"journal": "Gene",
"date": "2015",
"authors": "Hannah J, Zhou P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "26344709",
"url": "https://glygen.org/publication/PubMed/26344709"
}
]
},
{
"title": "The role and mechanism of CRL4 E3 ubiquitin ligase in cancer and its potential therapy implications.",
"journal": "Oncotarget",
"date": "2015",
"authors": "Sang Y, Yan F, Ren X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "26460955",
"url": "https://glygen.org/publication/PubMed/26460955"
}
]
},
{
"title": "Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.",
"journal": "Nature communications",
"date": "2015",
"authors": "Yu C, Mao H, Novitsky EJ, Tang X, Rychnovsky SD, Zheng N, Huang L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "26632597",
"url": "https://glygen.org/publication/PubMed/26632597"
}
]
},
{
"title": "Characterization of the mammalian family of DCN-type NEDD8 E3 ligases.",
"journal": "Journal of cell science",
"date": "2016",
"authors": "Keuss MJ, Thomas Y, Mcarthur R, Wood NT, Knebel A, Kurz T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "26906416",
"url": "https://glygen.org/publication/PubMed/26906416"
}
]
},
{
"title": "The role of cullin 5-containing ubiquitin ligases.",
"journal": "Cell division",
"date": "2016",
"authors": "Okumura F, Joo-Okumura A, Nakatsukasa K, Kamura T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "27030794",
"url": "https://glygen.org/publication/PubMed/27030794"
}
]
},
{
"title": "The structure and regulation of Cullin 2 based E3 ubiquitin ligases and their biological functions.",
"journal": "Cell division",
"date": "2016",
"authors": "Cai W, Yang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "27222660",
"url": "https://glygen.org/publication/PubMed/27222660"
}
]
},
{
"title": "Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.",
"journal": "Cell",
"date": "2016",
"authors": "Scott DC, Rhee DY, Duda DM, Kelsall IR, Olszewski JL, Paulo JA, de Jong A, Ovaa H, Alpi AF, Harper JW, Schulman BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "27565346",
"url": "https://glygen.org/publication/PubMed/27565346"
}
]
},
{
"title": "p97 Negatively Regulates NRF2 by Extracting Ubiquitylated NRF2 from the KEAP1-CUL3 E3 Complex.",
"journal": "Molecular and cellular biology",
"date": "2017",
"authors": "Tao S, Liu P, Luo G, Rojo de la Vega M, Chen H, Wu T, Tillotson J, Chapman E, Zhang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "28115426",
"url": "https://glygen.org/publication/PubMed/28115426"
}
]
},
{
"title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.",
"journal": "Analytical chemistry",
"date": "2017",
"authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "28510447",
"url": "https://glygen.org/publication/PubMed/28510447"
}
]
},
{
"title": "Blocking an N-terminal acetylation-dependent protein interaction inhibits an E3 ligase.",
"journal": "Nat. Chem. Biol.",
"date": "2017",
"authors": "Scott DC, Hammill JT, Min J, Rhee DY, Connelly M, Sviderskiy VO, Bhasin D, Chen Y, Ong SS, Chai SC, Goktug AN, Huang G, Monda JK, Low J, Kim HS, Paulo JA, Cannon JR, Shelat AA, Chen T, Kelsall IR, Alpi AF, Pagala V, Wang X, Peng J, Singh B, Harper JW, Schulman BA, Guy RK",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "28581483",
"url": "https://glygen.org/publication/PubMed/28581483"
}
]
},
{
"title": "VCP/p97-Mediated Unfolding as a Principle in Protein Homeostasis and Signaling.",
"journal": "Molecular cell",
"date": "2018",
"authors": "van den Boom J, Meyer H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "29153394",
"url": "https://glygen.org/publication/PubMed/29153394"
}
]
},
{
"title": "Therapeutic targeting of the NRF2 and KEAP1 partnership in chronic diseases.",
"journal": "Nature reviews. Drug discovery",
"date": "2019",
"authors": "Cuadrado A, Rojo AI, Wells G, Hayes JD, Cousin SP, Rumsey WL, Attucks OC, Franklin S, Levonen AL, Kensler TW, Dinkova-Kostova AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "30610225",
"url": "https://glygen.org/publication/PubMed/30610225"
}
]
},
{
"title": "Mitochondrial MUL1 E3 ubiquitin ligase regulates Hypoxia Inducible Factor (HIF-1alpha) and metabolic reprogramming by modulating the UBXN7 cofactor protein.",
"journal": "Scientific reports",
"date": "2020",
"authors": "Cilenti L, Di Gregorio J, Ambivero CT, Andl T, Liao R, Zervos AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "32005965",
"url": "https://glygen.org/publication/PubMed/32005965"
}
]
},
{
"title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.",
"journal": "Molecular and cellular biology",
"date": "2020",
"authors": "Baird L, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "32284348",
"url": "https://glygen.org/publication/PubMed/32284348"
}
]
},
{
"title": "UBC12-mediated SREBP-1 neddylation worsens metastatic tumor prognosis.",
"journal": "International journal of cancer",
"date": "2020",
"authors": "Heo MJ, Kang SH, Kim YS, Lee JM, Yu J, Kim HR, Lim H, Kim KM, Jung J, Jeong LS, Moon A, Kim SG",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
}
],
"reference": [
{
"type": "PubMed",
"id": "32449166",
"url": "https://glygen.org/publication/PubMed/32449166"
}
]
},
{
"title": "NEDD8-conjugating enzyme UBC12 as a novel therapeutic target in esophageal squamous cell carcinoma.",
"journal": "Signal transduction and targeted therapy",
"date": "2020",
"authors": "Wang S, Xian J, Li L, Jiang Y, Liu Y, Cai L, Hoffman RM, Jia L, Zhao H, Zhang Y",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
}
],
"reference": [
{
"type": "PubMed",
"id": "32651357",
"url": "https://glygen.org/publication/PubMed/32651357"
}
]
},
{
"title": "Ubiquitin conjugating enzyme E2 M promotes apoptosis in osteoarthritis chondrocytes via Wnt/beta-catenin signaling.",
"journal": "Biochemical and biophysical research communications",
"date": "2020",
"authors": "Ba C, Ni X, Yu J, Zou G, Zhu H",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
}
],
"reference": [
{
"type": "PubMed",
"id": "32819607",
"url": "https://glygen.org/publication/PubMed/32819607"
}
]
},
{
"title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.",
"journal": "Nature communications",
"date": "2020",
"authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "33214551",
"url": "https://glygen.org/publication/PubMed/33214551"
}
]
},
{
"title": "UBXN7 cofactor of CRL3(KEAP1) and CRL2(VHL) ubiquitin ligase complexes mediates reciprocal regulation of NRF2 and HIF-1alpha proteins.",
"journal": "Biochimica et biophysica acta. Molecular cell research",
"date": "2021",
"authors": "Di Gregorio J, Cilenti L, Ambivero CT, Andl T, Liao R, Zervos AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "33444648",
"url": "https://glygen.org/publication/PubMed/33444648"
}
]
},
{
"title": "NPRL2 reduces the niraparib sensitivity of castration-resistant prostate cancer via interacting with UBE2M and enhancing neddylation.",
"journal": "Experimental cell research",
"date": "2021",
"authors": "Zhao X, Jiang L, Hu D, Tang Y, Zhao G, Du X, Luo S, Tang W",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003960",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003960"
}
],
"reference": [
{
"type": "PubMed",
"id": "33905671",
"url": "https://glygen.org/publication/PubMed/33905671"
}
]
},
{
"title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.",
"journal": "Biochimica et biophysica acta. General subjects",
"date": "2021",
"authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "34019948",
"url": "https://glygen.org/publication/PubMed/34019948"
}
]
},
{
"title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2021",
"authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "34229054",
"url": "https://glygen.org/publication/PubMed/34229054"
}
]
},
{
"title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.",
"journal": "Analytical and bioanalytical chemistry",
"date": "2021",
"authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "34725712",
"url": "https://glygen.org/publication/PubMed/34725712"
}
]
},
{
"title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.",
"journal": "Journal of the American Chemical Society",
"date": "2022",
"authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P61081",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "35138101",
"url": "https://glygen.org/publication/PubMed/35138101"
}
]
},
{
"title": "The transforming growth factor beta receptors types I, II, and III form hetero-oligomeric complexes in the presence of ligand.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Moustakas A, Lin HY, Henis YI, Plamondon J, O'Connor-McCourt MD, Lodish HF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "7693660",
"url": "https://glygen.org/publication/PubMed/7693660"
}
]
},
{
"title": "Processing of transforming growth factor beta 1 precursor by human furin convertase.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Dubois CM, Laprise MH, Blanchette F, Gentry LE, Leduc R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "7737999",
"url": "https://glygen.org/publication/PubMed/7737999"
}
]
},
{
"title": "Mechanism of activation of the TGF-beta receptor.",
"journal": "Nature",
"date": "1994",
"authors": "Wrana JL, Attisano L, Wieser R, Ventura F, Massague J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "8047140",
"url": "https://glygen.org/publication/PubMed/8047140"
}
]
},
{
"title": "Cloning of a TGF beta type I receptor that forms a heteromeric complex with the TGF beta type II receptor.",
"journal": "Cell",
"date": "1993",
"authors": "Franzen P, ten Dijke P, Ichijo H, Yamashita H, Schulz P, Heldin CH, Miyazono K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "8242743",
"url": "https://glygen.org/publication/PubMed/8242743"
}
]
},
{
"title": "SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box.",
"journal": "Cell",
"date": "1996",
"authors": "Bai C, Sen P, Hofmann K, Ma L, Goebl M, Harper JW, Elledge SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "8706131",
"url": "https://glygen.org/publication/PubMed/8706131"
}
]
},
{
"title": "Differential nuclear localization of p50, p52, and RelB proteins in human accessory cells of the immune response in situ.",
"journal": "European journal of immunology",
"date": "1996",
"authors": "Feuillard J, Korner M, Israel A, Vassy J, Raphael M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "8921937",
"url": "https://glygen.org/publication/PubMed/8921937"
}
]
},
{
"title": "Phosphorylation of Ser165 in TGF-beta type I receptor modulates TGF-beta1-induced cellular responses.",
"journal": "The EMBO journal",
"date": "1996",
"authors": "Souchelnytskyi S, ten Dijke P, Miyazono K, Heldin CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "8947046",
"url": "https://glygen.org/publication/PubMed/8947046"
}
]
},
{
"title": "MADR2 is a substrate of the TGFbeta receptor and its phosphorylation is required for nuclear accumulation and signaling.",
"journal": "Cell",
"date": "1996",
"authors": "Macias-Silva M, Abdollah S, Hoodless PA, Pirone R, Attisano L, Wrana JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "8980228",
"url": "https://glygen.org/publication/PubMed/8980228"
}
]
},
{
"title": "Mechanism of TGFbeta receptor inhibition by FKBP12.",
"journal": "The EMBO journal",
"date": "1997",
"authors": "Chen YG, Liu F, Massague J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "9233797",
"url": "https://glygen.org/publication/PubMed/9233797"
}
]
},
{
"title": "TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.",
"journal": "The EMBO journal",
"date": "1997",
"authors": "Nakao A, Imamura T, Souchelnytskyi S, Kawabata M, Ishisaki A, Oeda E, Tamaki K, Hanai J, Heldin CH, Miyazono K, ten Dijke P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "9311995",
"url": "https://glygen.org/publication/PubMed/9311995"
}
]
},
{
"title": "F-box proteins are receptors that recruit phosphorylated substrates to the SCF ubiquitin-ligase complex.",
"journal": "Cell",
"date": "1997",
"authors": "Skowyra D, Craig KL, Tyers M, Elledge SJ, Harper JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "9346238",
"url": "https://glygen.org/publication/PubMed/9346238"
}
]
},
{
"title": "Phosphorylation of Ser465 and Ser467 in the C terminus of Smad2 mediates interaction with Smad4 and is required for transforming growth factor-beta signaling.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Souchelnytskyi S, Tamaki K, Engstrom U, Wernstedt C, ten Dijke P, Heldin CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "9346966",
"url": "https://glygen.org/publication/PubMed/9346966"
}
]
},
{
"title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Craiu A, Akopian T, Goldberg A, Rock KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9380723",
"url": "https://glygen.org/publication/PubMed/9380723"
}
]
},
{
"title": "NF-kappaB-inducing kinase activates IKK-alpha by phosphorylation of Ser-176.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1998",
"authors": "Ling L, Cao Z, Goeddel DV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5607761",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761"
}
],
"reference": [
{
"type": "PubMed",
"id": "9520446",
"url": "https://glygen.org/publication/PubMed/9520446"
}
]
},
{
"title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Beninga J, Rock KL, Goldberg AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-983168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9668046",
"url": "https://glygen.org/publication/PubMed/9668046"
}
]
},
{
"title": "A new NEDD8-ligating system for cullin-4A.",
"journal": "Genes Dev.",
"date": "1998",
"authors": "Osaka F, Kawasaki H, Aida N, Saeki M, Chiba T, Kawashima S, Tanaka K, Kato S",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"reference": [
{
"type": "PubMed",
"id": "9694792",
"url": "https://glygen.org/publication/PubMed/9694792"
}
]
},
{
"title": "Molecular determinants of NF-kappaB-inducing kinase action.",
"journal": "Molecular and cellular biology",
"date": "1998",
"authors": "Lin X, Mu Y, Cunningham ET Jr, Marcu KB, Geleziunas R, Greene WC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5676590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9742107",
"url": "https://glygen.org/publication/PubMed/9742107"
}
]
},
{
"title": "Cleavage of the C-terminus of NEDD8 by UCH-L3.",
"journal": "Biochemical and biophysical research communications",
"date": "1998",
"authors": "Wada H, Kito K, Caskey LS, Yeh ET, Kamitani T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "9790970",
"url": "https://glygen.org/publication/PubMed/9790970"
}
]
},
{
"title": "SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.",
"journal": "Cell",
"date": "1998",
"authors": "Tsukazaki T, Chiang TA, Davison AF, Attisano L, Wrana JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2173789",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789"
}
],
"reference": [
{
"type": "PubMed",
"id": "9865696",
"url": "https://glygen.org/publication/PubMed/9865696"
}
]
},
{
"title": "Keap1 represses nuclear activation of antioxidant responsive elements by Nrf2 through binding to the amino-terminal Neh2 domain.",
"journal": "Genes & development",
"date": "1999",
"authors": "Itoh K, Wakabayashi N, Katoh Y, Ishii T, Igarashi K, Engel JD, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "9887101",
"url": "https://glygen.org/publication/PubMed/9887101"
}
]
},
{
"title": "Transcription-dependent nuclear-cytoplasmic trafficking is required for the function of the von Hippel-Lindau tumor suppressor protein.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Lee S, Neumann M, Stearman R, Stauber R, Pause A, Pavlakis GN, Klausner RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8951664",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664"
}
],
"reference": [
{
"type": "PubMed",
"id": "9891082",
"url": "https://glygen.org/publication/PubMed/9891082"
}
]
}
],
"pathway": [
{
"id": "hsa:9040",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9040",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-2173789",
"name": "TGF-beta receptor signaling activates SMADs",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789",
"resource": "Reactome",
"description": "TGF-beta receptor signaling activates SMADs"
},
{
"id": "R-HSA-5607761",
"name": "Dectin-1 mediated noncanonical NF-kB signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761",
"resource": "Reactome",
"description": "Dectin-1 mediated noncanonical NF-kB signaling"
},
{
"id": "R-HSA-5676590",
"name": "NIK-->noncanonical NF-kB signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590",
"resource": "Reactome",
"description": "NIK-->noncanonical NF-kB signaling"
},
{
"id": "R-HSA-8951664",
"name": "Neddylation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664",
"resource": "Reactome",
"description": "Neddylation"
},
{
"id": "R-HSA-983168",
"name": "Antigen processing: Ubiquitination & Proteasome degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168",
"resource": "Reactome",
"description": "Antigen processing: Ubiquitination & Proteasome degradation"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "A0A8I5ZYZ8-1",
"protein_name": "Ubiquitin-conjugating enzyme E2M",
"gene_name": "Ube2m",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK",
"length": 183
},
"evidence": [
{
"id": "45239833",
"url": "http://www.informatics.jax.org/homology/45239833",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P61082-1",
"protein_name": "NEDD8-conjugating enzyme Ubc12",
"gene_name": "Ube2m",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK",
"length": 183
},
"evidence": [
{
"id": "45239833",
"url": "http://www.informatics.jax.org/homology/45239833",
"database": "MGI"
},
{
"id": "P61081",
"url": "https://omabrowser.org/oma/group/P61081/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q9VSF3-1",
"protein_name": "Nedd8-conjugating enzyme UbcE2M",
"gene_name": "UbcE2M",
"tax_id": 7227,
"organism": "Drosophila melanogaster",
"sequence": {
"sequence": "MIKLFTLKQQKKDGEQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCLLK",
"length": 181
},
"evidence": [
{
"id": "P61081",
"url": "https://omabrowser.org/oma/group/P61081/",
"database": "OMA"
}
],
"common_name": "Fruit fly"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 5,
"go_terms": [
{
"name": "ATP binding",
"id": "GO:0005524",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "ubiquitin-like protein transferase activity",
"id": "GO:0019787",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019787",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "NEDD8 conjugating enzyme activity",
"id": "GO:0061654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061654",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "ubiquitin-protein transferase activity",
"id": "GO:0004842",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "NEDD8 transferase activity",
"id": "GO:0019788",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019788",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 5,
"go_terms": [
{
"name": "protein modification by small protein conjugation",
"id": "GO:0032446",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032446",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "protein modification process",
"id": "GO:0036211",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "post-translational protein modification",
"id": "GO:0043687",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043687",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "positive regulation of neuron apoptotic process",
"id": "GO:0043525",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "protein neddylation",
"id": "GO:0045116",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045116",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 3,
"go_terms": [
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [
{
"annotation": "The acetylation of Met-1 increases affinity for DCUN1D1 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.",
"evidence": [
{
"database": "UniProtKB",
"id": "P61081",
"url": "https://www.uniprot.org/uniprot/P61081"
},
{
"database": "PubMed",
"id": "21940857",
"url": "https://glygen.org/publication/PubMed/21940857"
},
{
"database": "PubMed",
"id": "23201271",
"url": "https://glygen.org/publication/PubMed/23201271"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "R-HSA-4332236",
"name": "CBL neddylates TGFBR2",
"equation": "",
"summary": "CBL neddylates TGFBR2 on lysine residues K556 and K567. The E3 ubiquitin ligase activity of CBL is necessary for this modification, and the kinase activity of TGFBR2 is also required. CBL-mediated neddylation prolongs the half-life of TGFBR2, thereby enhancing signaling by the TGF-beta receptor complex. CBLB, a CBL-related protein, may cooperate with CBL in TGFBR2 neddylation (Zuo et al. 2013).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P22681-1",
"P37173-1"
],
"evidence": [
{
"id": "R-HSA-4332236",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4332236"
}
]
},
{
"id": "R-HSA-5607725",
"name": "SCF-beta-TRCP ubiquitinates p-7S-p100:RELB in active NIK:p-176,S180-IKKA dimer:p-7S-p100:SCF-beta-TRCP",
"equation": "",
"summary": "Ubiquitination of p100 is very specific. Lysine residue K855 has been identified as the anchoring site for ubiquitin and required for signaling mediated processing of p100 to p52. In the presence of SCF-beta-TRCP E3 ligase the ubiquitin (Ub) conjugated to E2 (E2-Ub thioester) is attached to p100 at K855 (Amir et al. 2004). Several rounds of ubiquitin conjugation can produce long chains of ubiquitin moieties (polyubiquitylation), the first of which is covalently bound to p100. At this point the polyubiquitylated p100 is committed to association with, and unfolding and processing by, the 26S proteasome (Pickart & Cohen 2004).
Efficient ubiquitination of phosphorylated p100 by SCF-beta-TRCP E3 ligase also requires the presence of the components of the NEDD8 pathway: UBA3 (NEDD8-activating enzyme E1 catalytic subunit), UBC12 (NEDD8-conjugating enzyme Ubc12 (E2)), NEDD8 (Neural precursor cell expressed developmentally down-regulated protein 8). NEDD8 binds and promotes a conformational change in CUL1 that may result in efficient formation of an E2-E3 complex, thus stimulating SCF complexes activity (Kawakami et al. 2001, Morimoto et al. 2000, Read et al. 2000).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-HSA-4419894"
],
"output_participant_list": [
"R-HSA-4419894",
"R-HSA-947632"
],
"enzyme_list": [
"P61081-1",
"O15111-1",
"Q99558-1",
"Q8TBC4-1"
],
"evidence": [
{
"id": "R-HSA-5607725",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607725"
}
]
},
{
"id": "R-HSA-8951661",
"name": "Transfer of NEDD8 to AcM-UBE2M",
"equation": "",
"summary": "UBA3:NAE1 transfers NEDD8 to the catalytic cysteine residue of UBE2M. Because two of the three E1-E2 interaction interfaces are created by conformational states present in the doubly-NEDDylated NAE1, transfer of NEDD8 to UBE2M is thought to weaken the interaction between UBA3:NAE1 and UBE2M, contributing to UBE2M release (Walden et al, 2003; Huang et al, 2004; Hunag et al, 2005; Huang et al, 2007).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"Q8TBC4-1"
],
"evidence": [
{
"id": "R-HSA-8951661",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951661"
}
]
},
{
"id": "R-HSA-8951751",
"name": "Doubly neddylated UBA3:NAE1 binds AcM-UBE2M",
"equation": "",
"summary": "When NAE1:UBA3 is doubly loaded with NEDD8 (one molecule covalently attached to the catalytic cysteine and the other bound in the adenylation site), the E1 enzyme is competent to interact with either of its E2 enzymes, UBE2F and UBE2M (also known as UBC12). Three binding interfaces contribute to the interaction of the E1 and E2 enzymes. When doubly neddylated, the \\ubiquitin\\ folding domain of NAE1 reorients and, in conjunction with the adenylation domain, forms a cryptic E2-binding site. The adenylation domain also makes contact with the amino terminus of either E2 enzyme. UBE2M additionally interacts directly with the NEDD8 molecule covalently attached to the E1 catalytic cysteine (Huang et al, 2004; Huang et al, 2007; reviewed in Enchev et al, 2015). UBE2M is the E2 responsible for transfer of NEDD8 to RBX1-containing E3 ligase complexes, such as those formed with cullins 1, 2, 3 and 4. In contrast, UBE2F is the E2 for the CUL5:RBX2-containing E3 ligase (Huang et al, 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"Q8TBC4-1"
],
"evidence": [
{
"id": "R-HSA-8951751",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951751"
}
]
},
{
"id": "R-HSA-8952618",
"name": "AcM-UBE2M transfers NEDD8 to CRL1 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M transfers NEDD8 to lysine 720 of CUL1 in the CRL E3 ubiquitin ligase complex (Hori et al, 1999; Duda et al, 2008). Neddylation increases the ubiquitination activity of the E3 complex towards its targets, and prevents binding of the CUL1 complex with the CAND1 inhibitor (Hori et al, 1999; Goldenberg et al, 2004; Duda et al, 2008; Kelsall et al, 2013; Scott et al, 2016). Targets of CUL1 RING complexes include a variety of cellular proteins including regulators of transcription and cell cycle progression, among others (reviewed in Lipkowitz and Weissman, 2011). CRL1 complexes are also hijacked by viruses, redirecting the ubiquitin ligase complex to target host proteins (reviewed in Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952618",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952618"
}
]
},
{
"id": "R-HSA-8952620",
"name": "NEDD8:AcM-UBE2M binds CRL1 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M is the E2 for CRL complexes containing cullin 1, 2, 3 and 4 (Huang et al, 2009; Monda et al, 2013). Interaction between UBE2M and the CUL1 E3 complex is facilitated by a DCUN1D (also known as DCNL) scaffold protein, of which there are 5 in human cells (Kim et al, 2008; Kurz et al, 2008; Meyer-Schaller et al, 2009; Monda et al, 2013; Keuss et al, 2016). DCUN1D proteins interact with higher affinity to the N-terminally acetylated forms of UBE2F and UBE2M (Scott et al, 2011; Monda et al, 2013). Although each of the 5 DCUN1D proteins appears to interact with most cullin subtypes, specificity may arise through differences in expression and localization, and DCUN1D3 may play a specialized role in sequestering CRL E3 ligase complexes at the cell membrane (Monda et al, 2013; Keuss et al, 2016; Meyer-Schaller et al, 2009; Huang et al, 2014; reviewed in Enchev et al, 2103). Although in this pathway, COMMD proteins and DCUN1D are shown acting sequentially in the activation of the CRL E3 ligase complex, the relationship between these protein families is not totally clear, as DCUN1D proteins have been identified in complexes that also contain the inhibitor CAND1 (Kim et al, 2008; Huang et al, 2014).; Target specificity of the CRL1 complex is directed by the nature of the F box substrate recognition protein, of which there are more than 60 in humans. Identified targets of CRL1-containing complexes include signaling molecules, transcriptional regulators and regulators of cell cycle progression, among others (reviewed in Gutierrez and Ronai, 2006; Lipkowitz and Weissman, 2011). CRL1 complexes are also hijacked by a number of viruses, redirecting the ubiquitin ligase complex to target host proteins and in this way promoting viral propagation (reveiwed in Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952620",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952620"
}
]
},
{
"id": "R-HSA-8952625",
"name": "NEDD8:AcM-UBE2M binds CRL2 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M is the E2 ubiquitin ligase for CRL complexes containing cullin 1, 2, 3 and 4 (Huang et al, 2009; Monda et al, 2013). Interaction between UBE2M and the CUL2 E3 complex is facilitated by a DCUN1D (also known as DCNL) scaffold protein, of which there are 5 in human cells (Kim et al, 2008; Kurz et al, 2008; Meyer-Schaller et al, 2009; Monda et al, 2013; Keuss et al, 2016). DCUN1D proteins interact with higher affinity to the N-terminally acetylated forms of UBE2F and UBE2M (Scott et al, 2011; Monda et al, 2013). Although each of the 5 DCUN1D proteins appears to interact with most cullin subtypes, specificity may arise through differences in expression and localization, and DCUN1D3 may play a specialized role in sequestering CRL E3 ligase complexes at the cell membrane (Monda et al, 2013; Keuss et al, 2016; Meyer-Schaller et al, 2009; Huang et al, 2014; reviewed in Enchev et al, 2103). Although in this pathway, COMMD proteins and DCUN1D are shown acting sequentially in the activation of the CRL E3 ligase complex, the relationship between these protein families is not totally clear, as DCUN1D proteins have been identified in complexes that also contain the inhibitor CAND1 (Kim et al, 2008; Huang et al, 2014).
Target specificity of the CRL2 complex is directed by the nature of the F box substrate recognition protein. The best characterized CRL2 F-box protein is the von Hippel-Lindau (VHL) tumor suppressor, which targets the alpha subunit of hypoxia inducible factor (HIFalpha), among other substrates (reviewed in Cai and Yang, 2016). Another example is CRL1/HRD1 that has been reported to target NFE2L2 for degradation in liver (Wu et al, 2014). CRL2 complexes are hijacked by a number of viruses, including adenovirus, Epstein-Barr virus and HPV, among others. This redirects the ubiquitin ligase complex to target host proteins and in this way promotes viral propagation (reviewed in Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952625",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952625"
}
]
},
{
"id": "R-HSA-8952626",
"name": "AcM-UBE2M transfers NEDD8 to CRL2 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M transfers NEDD8 to lysine 689 of CUL2 in the E3 ligase complex (Hori et al, 1999; Duda et al, 2008). Neddylation increases the ubiquitin ligase activity of the E3 complex towards its targets, and prevents binding of the CUL2 complex with the CAND1 inhibitor (Hori et al, 1999; Duda et al, 2008).
Target specificity of the CRL2 complex is directed by the nature of the F box substrate recognition protein. The best characterized CRL2 F-box protein is the von Hippel- Lindau (VHL) tumor suppressor, which targets the alpha subunit of hypoxia inducible factor (HIFalpha), among other substrates (reviewed in Cai and Yang, 2016). Another example if CRL2/HRD1 that has been reported to target NFE2L2 for degradation in liver (Wu et al, 2014). CRL2 complexes are hijacked by a number of viruses, including adenovirus, Epstein-Barr virus and HPV, among others. This redirects the ubiquitin ligase complex to target host proteins and in this way promotes viral propagation (reviewed in Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952626",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952626"
}
]
},
{
"id": "R-HSA-8952630",
"name": "NEDD8:AcM-UBE2M binds CRL3 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M is the E2 for CRL complexes containing cullin 1, 2, 3 and 4 (Huang et al, 2009; Monda et al, 2013). Interaction between UBE2M and the CUL3 E3 complex is facilitated by a DCUN1D (also known as DCNL) scaffold protein, of which there are 5 in human cells (Kim et al, 2008; Kurz et al, 2008; Meyer-Schaller et al, 2009; Monda et al, 2013; Keuss et al, 2016). DCUN1D proteins interact with higher affinity to the N-terminally acetylated forms of UBE2F and UBE2M (Scott et al, 2011; Monda et al, 2013). Although each of the 5 DCUN1D proteins appears to interact with most cullin subtypes, specificity may arise through differences in expression and localization, and DCUN1D3 may play a specialized role in sequestering CRL E3 ligase complexes at the cell membrane (Monda et al, 2013; Keuss et al, 2016; Meyer-Schaller et al, 2009; Huang et al, 2014; reviewed in Enchev et al, 2103). Although in this pathway, COMMD proteins and DCUN1D are shown acting sequentially in the activation of the CRL E3 ligase complex, the relationship between these protein families is not totally clear, as DCUN1D proteins have been identified in complexes that also contain the inhibitor CAND1 (Kim et al, 2008; Huang et al, 2014).
Target specificity of the CRL3 complex is directed by the nature of the BTB substrate recognition protein. For instance, BTB protein KEAP1 is the main controller of NFE2L2 stability (Cuadrado et al, 2019). CRL3 complexes target proteins involved in processes such as development and stress response (reviewed in Genschik et al, 2013). CRL3 complexes are also hijacked by a number of viruses, redirecting the ubiquitin ligase complex to target host proteins and in this way promoting viral propagation (reviewed in Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952630",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952630"
}
]
},
{
"id": "R-HSA-8952631",
"name": "AcM-UBE2M transfers NEDD8 to CRL3 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M transfers NEDD8 to lysine 712 of CUL3 in the E3 ligase complex (Hori et al, 1999; Duda et al, 2008). Neddylation increases the ubiquitin ligase activity of the E3 complex towards its targets, and prevents binding of the CUL3 complex with the CAND1 inhibitor (Hori et al, 1999; Duda et al, 2008). CRL3 ubiquitin ligase complexes target substrates through a BTB substrate recognition protein, and regulate processes such as development and stress response, as well as viral replication (reviewed in Genschik et al, 2013; Mahon et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8952631",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952631"
}
]
},
{
"id": "R-HSA-8952638",
"name": "AcM-UBE2M transfers NEDD8 to CRL4 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M transfers NEDD8 to lysine 705 of CUL4A and lysine 859 of CUL4B (Hori et al, 1999; Duda et al, 2008). Neddylation increases the ubiquitination activity of the E3 complex towards its targets, and prevents binding of the CUL4 complex with the CAND1 inhibitor (Hori et al, 1999; Duda et al, 2008). CRL4 complexes ubiquitinate target proteins involved in processes such as cell cycle progression, DNA repair and replication, cell growth and metabolism (reviewed in Hannah and Zhou, 2015; Sang et al, 2015). CRL4 complexes are also hijacked by a number of viruses, redirecting the ubiquitin ligase complex to target host proteins and in this way promoting viral propagation (reveiwed in Mahon et al, 2014). Note that because many of the key CRL4 ubiquitin targets are nuclear, these complexes are depicted in the nucleus. Cytoplasmic targets have also been identified, however (reviewed in Hannah and Zhou, 2015).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1",
"Q8NHY2-1"
],
"evidence": [
{
"id": "R-HSA-8952638",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952638"
}
]
},
{
"id": "R-HSA-8952639",
"name": "NEDD8:AcM-UBE2M binds CRL4 E3 ubiquitin ligase complex",
"equation": "",
"summary": "UBE2M is the E2 for CRL complexes containing cullin 1, 2, 3 and 4 (Huang et al, 2009; Monda et al, 2013). Interaction between UBE2M and the CUL4A and 4B E3 complex is facilitated by a DCUN1D (also known as DCNL) scaffold protein, of which there are 5 in human cells (Kim et al, 2008; Kurz et al, 2008; Meyer-Schaller et al, 2009; Monda et al, 2013; Keuss et al, 2016). DCUN1D proteins interact with higher affinity to the N-terminally acetylated forms of UBE2F and UBE2M (Scott et al, 2011; Monda et al, 2013). Although each of the 5 DCUN1D proteins appears to interact with most cullin subtypes, specificity may arise through differences in expression and localization, and DCUN1D3 may play a specialized role in sequestering CRL E3 ligase complexes at the cell membrane (Monda et al, 2013; Keuss et al, 2016; Meyer-Schaller et al, 2009; Huang et al, 2014; reviewed in Enchev et al, 2103). Although in this pathway, COMMD proteins and DCUN1D are shown acting sequentially in the activation of the CRL E3 ligase complex, the relationship between these protein families is not totally clear, as DCUN1D proteins have been identified in complexes that also contain the inhibitor CAND1 (Kim et al, 2008; Huang et al, 2014).
CRL4 complexes ubiquitinate target proteins involved in processes such as cell cycle progression, DNA repair and replication, cell growth and metabolism (reviewed in Hannah and Zhou, 2015; Sang et al, 2015). CRL4 complexes are also hijacked by a number of viruses, redirecting the ubiquitin ligase complex to target host proteins and in this way promoting viral propagation (reviewed in Mahon et al, 2014). Note that because many of the key CRL4 ubiquitin targets are nuclear, these complexes are depicted in the nucleus. Cytoplasmic targets have also been identified, however (reviewed in Hannah and Zhou, 2015).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1",
"Q8NHY2-1"
],
"evidence": [
{
"id": "R-HSA-8952639",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952639"
}
]
},
{
"id": "R-HSA-8956025",
"name": "AcM-UBE2M transfers NEDD8 to CUL9:RBX1",
"equation": "",
"summary": "UBE2M transfers NEDD8 to lysine 1881 of CUL9 (Skaar et al, 2007; Li et al, 2014). Neddylation increases the ubiquitination activity of the E3 complex towards its targets (Hori et al, 1999; Duda et al, 2008). One defined target of CUL9 is BIRC5 (also known as Survivin), which has roles in cellular proliferation, inhibition of apoptosis and maintenance of genome stability (Zhao et al, 2000; Watanabe, 2010). CUL9-mediated ubiquitination of BIRC5 is negatively regulated by the 3M complex, consisting of CUL7, CCDC8 and OBSL1 (Li et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8956025",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8956025"
}
]
},
{
"id": "R-HSA-8956031",
"name": "NEDD8:AcM-UBE2M binds CUL9:RBX1 ubiquitin ligase complex",
"equation": "",
"summary": "CUL9 (also known as PARC for p53-associated PARkin-like cytoplasmic protein) is an atypical cullin that has been shown to form a ubiquitin ligase complex with RBX1, although other components of the putative CRL9 complex have not yet been identified (Skaar et al, 2007; Li et al, 2014). CUL9:RBX1 is neddylated in vivo, likely through the UBE2M E2 although this hasn't been directly demonstrated (Skaar et al, 2007).
CUL9 is 60% identical to CUL7, another atypical mammalian cullin family member, but more distantly related to CUL1, 2, 3, 4A,4B and 5. CUL9 and CUL7 have been shown to form a heterodimer in vivo, and both interact with p53 (Skaar et al, 2007; Andrews et al, 2006; Nikolaev et al, 2003). CUL9 ubiquitinates BIRC5 (also known as Survivin), a protein with roles in cellular proliferation and inhibition of apoptosis. CUL9-mediated ubiquitination of BIRC5 is inhibited by the 3M complex, which consists of CUL7, CCDC8 and OBSL1 (Li et al, 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P61081-1",
"P62877-1"
],
"evidence": [
{
"id": "R-HSA-8956031",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8956031"
}
]
},
{
"id": "R-HSA-983140",
"name": "Transfer of Ub from E2 to substrate and release of E2",
"equation": "",
"summary": "Interaction of E3 with both substrate and E2-Ub, brings them into proximity so that ubiquitin is transferred from E2 to the substrate. In most cases the transfer of ubiquitin is direct from E2 to substrate, but in a small subset of E3s, it occurs via a covalent E3-Ub thioester intermediate (Raymond et al. 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983140",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983140"
}
]
},
{
"id": "R-HSA-983152",
"name": "Transfer of ubiquitin from E1 to E2",
"equation": "",
"summary": "Activated ubiquitin is transferred from E1 to the active site cystine of ubiquitin conjugating enzymes (E2s) via a trans-esterification reaction. E2s catalyze covalent attachment of ubiquitin to target proteins. They all share an active-site ubiquitin-binding cysteine residue and are distinguished by the presence of a ubiquitin-conjugating catalytic (UBC) fold required for binding of distinct ubiquitin ligases or E3s. Once conjugated to ubiquitin, the E2 molecule binds one of several E3s (Glickman et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"A0AVT1-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9Y2X8-1",
"P49427-1",
"P61081-1",
"P22314-1",
"Q5VVX9-1",
"Q16763-1",
"P60604-1",
"Q712K3-1",
"O14933-1",
"P68036-1",
"Q96LR5-1",
"P49459-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"P51965-1",
"P61088-1",
"P62837-1",
"P62253-1",
"Q9Y385-1",
"P61086-1",
"Q8TBC4-1",
"P62256-1",
"Q96B02-1",
"P63146-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983152",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983152"
}
]
},
{
"id": "R-HSA-983156",
"name": "Polyubiquitination of substrate",
"equation": "",
"summary": "Monoubiquitinated substrate acquires additional ubiquitin modifications in the form of multiple single attachments or a ubiquitin chain. Polyubiquitin chains added through K48 residue of ubiquitin typically targets the substrate for degradation (Raymond et al. 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983156",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983156"
}
]
},
{
"id": "R-HSA-983157",
"name": "Interaction of E3 with substrate and E2-Ub complex",
"equation": "",
"summary": "Ubiquitin E3 ligases confer specificity to ubiquitination by recognizing target substrates and mediating transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to substrate (Raymond et al. 2009). E3 ligases includes a large, diverse set of proteins characterized by several defining motifs which include a HECT (homologous to E6-associated C-terminus), RING (Really Interesting New Gene) and U-box domains. The E3 ligases can be multisubunit complexes rather than a single polypeptide. Presently three different kinds of E3 complexes have been described called SCF, APC, and VHL. E3 ligases binds to both substrate and an E2 thioesterified with ubiquitin (E2-Ub).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BYM8-1",
"Q9H832-1",
"Q969T4-1",
"Q7Z7E8-1",
"Q9UHC7-1",
"Q96PU5-1",
"Q9Y2X8-1",
"Q9Y4L5-1",
"Q8TDB6-1",
"Q9NQ86-1",
"O43255-1",
"Q96BH1-1",
"P49427-1",
"P61081-1",
"P62877-1",
"Q8WVD3-1",
"Q15386-1",
"Q5VVX9-1",
"Q86XS8-1",
"O94822-1",
"Q2Q1W2-1",
"O60291-1",
"Q5U5Q3-1",
"Q96AX9-1",
"Q96F44-1",
"Q9NVW2-1",
"O94874-1",
"Q7Z3V4-1",
"Q8IUQ4-1",
"Q13049-1",
"Q9UNE7-1",
"Q16763-1",
"Q86Y13-1",
"Q8TBB1-1",
"Q8WV44-1",
"Q96PM5-1",
"Q9C026-1",
"O60260-1",
"Q9UBS8-1",
"Q9Y252-1",
"P60604-1",
"Q712K3-1",
"Q969K3-1",
"O15033-1",
"O94972-1",
"Q86WT6-1",
"Q9H4P4-1",
"Q13191-1",
"Q14669-1",
"Q7Z6Z7-1",
"O14933-1",
"O95376-1",
"P68036-1",
"Q96LR5-1",
"Q7Z419-1",
"Q96J02-1",
"Q9BV68-1",
"Q969Q1-1",
"Q9H0M0-1",
"Q9HAU4-1",
"Q9HCE7-1",
"Q5T447-1",
"Q15751-1",
"Q9UII4-1",
"Q05086-1",
"O43164-1",
"Q86XT4-1",
"P78317-1",
"P49459-1",
"Q7Z6E9-1",
"Q5VTB9-1",
"Q5XPI4-1",
"Q63HN8-3",
"Q6ZMZ0-1",
"Q9C0C9-1",
"P51668-1",
"P61077-1",
"Q9Y508-1",
"P51965-1",
"P61088-1",
"P62837-1",
"Q6ZNA4-1",
"P62253-1",
"Q7Z6J8-1",
"Q8IWV8-1",
"Q8ND25-1",
"Q9Y385-1",
"Q5T4S7-1",
"Q8N7E2-1",
"Q8NHG8-1",
"Q9HCM9-1",
"P19474-1",
"Q8WY64-1",
"Q9Y4B6-1",
"Q6Q0C0-1",
"Q6UWE0-1",
"Q8N6D2-1",
"Q8TC41-1",
"Q9NV58-1",
"P61086-1",
"P46934-1",
"P62256-1",
"Q14139-1",
"Q96B02-1",
"Q9C037-1",
"Q8IYU2-1",
"Q9P2P5-1",
"O95714-1",
"Q15034-1",
"Q8NG27-1",
"Q9BWF2-1",
"O94941-1",
"P63146-1",
"Q5GLZ8-1",
"Q5U5R9-1",
"Q8IVU3-1",
"Q9ULT8-1",
"Q7Z6J0-1",
"Q9H9P5-4",
"Q8IWV7-1",
"Q8N2K1-1",
"Q969M7-1",
"O00762-1",
"Q8WVN8-1"
],
"evidence": [
{
"id": "R-HSA-983157",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983157"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-HSA-4419894",
"participant_name": "G76-NEDD8-C111-AcM-UBE2M [cytosol]",
"crossref": [
{
"id": "ENSP00000253023",
"database": "Ensembl",
"url": ""
},
{
"id": "1TT5",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000130725-UBE2M",
"database": "HPA",
"url": ""
},
{
"id": "ENSG00000130725",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000253023",
"database": "Ensembl",
"url": ""
},
{
"id": "P61081",
"database": "GeneCards",
"url": ""
},
{
"id": "NP_003960.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000130725",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP00563",
"database": "HMDB Protein",
"url": ""
},
{
"id": "4GAO",
"database": "PDB",
"url": ""
},
{
"id": "1Y8X",
"database": "PDB",
"url": ""
},
{
"id": "4P5O",
"database": "PDB",
"url": ""
},
{
"id": "3TDU",
"database": "PDB",
"url": ""
},
{
"id": "P61081",
"database": "PRO",
"url": ""
},
{
"id": "2NVU",
"database": "PDB",
"url": ""
},
{
"id": "3TDZ",
"database": "PDB",
"url": ""
},
{
"id": "P61081",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "P61081",
"database": "UniProt",
"url": ""
}
]
},
{
"participant_id": "R-HSA-947632",
"participant_name": "UBA3 [cytosol]",
"crossref": [
{
"id": "Q8TBC4",
"database": "UniProt",
"url": ""
},
{
"id": "ENST00000361055",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000354340",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000349511",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000144744",
"database": "Ensembl",
"url": ""
},
{
"id": "Q8TBC4",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000340041",
"database": "Ensembl",
"url": ""
},
{
"id": "3DBL",
"database": "PDB",
"url": ""
},
{
"id": "Q8TBC4",
"database": "GeneCards",
"url": ""
},
{
"id": "1YOV",
"database": "PDB",
"url": ""
},
{
"id": "5JJM",
"database": "PDB",
"url": ""
},
{
"id": "Q8TBC4",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "3DBH",
"database": "PDB",
"url": ""
},
{
"id": "1Y8X",
"database": "PDB",
"url": ""
},
{
"id": "3GZN",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000144744",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_003959.3",
"database": "RefSeq",
"url": ""
},
{
"id": "1R4N",
"database": "PDB",
"url": ""
},
{
"id": "2NVU",
"database": "PDB",
"url": ""
},
{
"id": "3FN1",
"database": "PDB",
"url": ""
},
{
"id": "NP_937838.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1TT5",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000144744-UBA3",
"database": "HPA",
"url": ""
},
{
"id": "1R4M",
"database": "PDB",
"url": ""
},
{
"id": "3DBR",
"database": "PDB",
"url": ""
},
{
"id": "2LQ7",
"database": "PDB",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0AVT1",
"gene_name": "UBA6",
"activity": [
{
"ec_number": "6.2.1.45",
"activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.",
"evidence": [
{
"id": "A0AVT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0AVT1"
}
]
},
{
"ec_number": "6.2.1.45",
"activity": "",
"evidence": [
{
"id": "A0AVT1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0AVT1"
}
]
}
]
},
{
"uniprot_ac": "O00762",
"gene_name": "UBE2C",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "O00762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00762"
}
]
}
]
},
{
"uniprot_ac": "O14933",
"gene_name": "UBE2L6",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "O14933",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14933"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "O14933",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14933"
}
]
}
]
},
{
"uniprot_ac": "O15033",
"gene_name": "AREL1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O15033",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15033"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "O15033",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15033"
}
]
}
]
},
{
"uniprot_ac": "O15111",
"gene_name": "CHUK",
"activity": [
{
"ec_number": "2.7.11.10",
"activity": "ATP + L-seryl-[I-kappa-B protein] = ADP + H(+) + O-phospho-L-seryl-[I-kappa-B protein].",
"evidence": [
{
"id": "O15111",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15111"
}
]
},
{
"ec_number": "2.7.11.10",
"activity": "",
"evidence": [
{
"id": "O15111",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15111"
}
]
}
]
},
{
"uniprot_ac": "O43164",
"gene_name": "PJA2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O43164",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43164"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O43164",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43164"
}
]
}
]
},
{
"uniprot_ac": "O43255",
"gene_name": "SIAH2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O43255",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43255"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O43255",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43255"
}
]
}
]
},
{
"uniprot_ac": "O60260",
"gene_name": "PRKN",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
},
{
"ec_number": "6.3.2.19",
"activity": "",
"evidence": [
{
"id": "O60260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60260"
}
]
}
]
},
{
"uniprot_ac": "O60291",
"gene_name": "MGRN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O60291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60291"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O60291",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60291"
}
]
}
]
},
{
"uniprot_ac": "O94822",
"gene_name": "LTN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94822",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94822"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94822",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94822"
}
]
}
]
},
{
"uniprot_ac": "O94874",
"gene_name": "UFL1",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "O94874",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94874"
}
]
}
]
},
{
"uniprot_ac": "O94941",
"gene_name": "UBOX5",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94941"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94941"
}
]
}
]
},
{
"uniprot_ac": "O94972",
"gene_name": "TRIM37",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O94972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94972"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "O94972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O94972"
}
]
}
]
},
{
"uniprot_ac": "O95376",
"gene_name": "ARIH2",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "O95376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95376"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "O95376",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95376"
}
]
}
]
},
{
"uniprot_ac": "O95714",
"gene_name": "HERC2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "O95714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95714"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "O95714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95714"
}
]
}
]
},
{
"uniprot_ac": "P19474",
"gene_name": "TRIM21",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P19474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19474"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P19474",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19474"
}
]
}
]
},
{
"uniprot_ac": "P22314",
"gene_name": "UBA1",
"activity": [
{
"ec_number": "6.2.1.45",
"activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P22314",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22314"
}
]
},
{
"ec_number": "6.2.1.45",
"activity": "",
"evidence": [
{
"id": "P22314",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22314"
}
]
}
]
},
{
"uniprot_ac": "P22681",
"gene_name": "CBL",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P22681",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22681"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P22681",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22681"
}
]
}
]
},
{
"uniprot_ac": "P37173",
"gene_name": "TGFBR2",
"activity": [
{
"ec_number": "2.7.11.30",
"activity": "ATP + L-threonyl-[receptor-protein] = ADP + H(+) + O-phospho-L-threonyl-[receptor-protein].",
"evidence": [
{
"id": "P37173",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P37173"
}
]
},
{
"ec_number": "2.7.11.30",
"activity": "",
"evidence": [
{
"id": "P37173",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P37173"
}
]
}
]
},
{
"uniprot_ac": "P46934",
"gene_name": "NEDD4",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P46934",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46934"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "P46934",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46934"
}
]
}
]
},
{
"uniprot_ac": "P49427",
"gene_name": "CDC34",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P49427",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49427"
}
]
}
]
},
{
"uniprot_ac": "P49459",
"gene_name": "UBE2A",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P49459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49459"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P49459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49459"
}
]
}
]
},
{
"uniprot_ac": "P51668",
"gene_name": "UBE2D1",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P51668",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51668"
}
]
}
]
},
{
"uniprot_ac": "P51965",
"gene_name": "UBE2E1",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P51965",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51965"
}
]
}
]
},
{
"uniprot_ac": "P60604",
"gene_name": "UBE2G2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P60604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60604"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P60604",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60604"
}
]
}
]
},
{
"uniprot_ac": "P61077",
"gene_name": "UBE2D3",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61077",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61077"
}
]
}
]
},
{
"uniprot_ac": "P61081",
"gene_name": "UBE2M",
"activity": [
{
"ec_number": "2.3.2.34",
"activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.",
"evidence": [
{
"id": "P61081",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61081"
}
]
},
{
"ec_number": "2.3.2.34",
"activity": "",
"evidence": [
{
"id": "P61081",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61081"
}
]
}
]
},
{
"uniprot_ac": "P61086",
"gene_name": "UBE2K",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61086"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61086"
}
]
}
]
},
{
"uniprot_ac": "P61088",
"gene_name": "UBE2N",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P61088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61088"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P61088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61088"
}
]
}
]
},
{
"uniprot_ac": "P62253",
"gene_name": "UBE2G1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62253"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62253"
}
]
}
]
},
{
"uniprot_ac": "P62256",
"gene_name": "UBE2H",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62256",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62256"
}
]
}
]
},
{
"uniprot_ac": "P62837",
"gene_name": "UBE2D2",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P62837",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62837"
}
]
}
]
},
{
"uniprot_ac": "P62877",
"gene_name": "RBX1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P62877",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62877"
}
]
}
]
},
{
"uniprot_ac": "P63146",
"gene_name": "UBE2B",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P63146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63146"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P63146",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63146"
}
]
}
]
},
{
"uniprot_ac": "P68036",
"gene_name": "UBE2L3",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "P68036",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68036"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "P68036",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68036"
}
]
}
]
},
{
"uniprot_ac": "P78317",
"gene_name": "RNF4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "P78317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78317"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "P78317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78317"
}
]
}
]
},
{
"uniprot_ac": "Q05086",
"gene_name": "UBE3A",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q05086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05086"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q05086",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05086"
}
]
}
]
},
{
"uniprot_ac": "Q13049",
"gene_name": "TRIM32",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q13049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13049"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q13049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13049"
}
]
}
]
},
{
"uniprot_ac": "Q13191",
"gene_name": "CBLB",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q13191",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13191"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q13191",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13191"
}
]
}
]
},
{
"uniprot_ac": "Q14139",
"gene_name": "UBE4A",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q14139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14139"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q14139",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14139"
}
]
}
]
},
{
"uniprot_ac": "Q14669",
"gene_name": "TRIP12",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q14669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14669"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q14669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14669"
}
]
}
]
},
{
"uniprot_ac": "Q15034",
"gene_name": "HERC3",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15034",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15034"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15034",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15034"
}
]
}
]
},
{
"uniprot_ac": "Q15386",
"gene_name": "UBE3C",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15386",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15386"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15386",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15386"
}
]
}
]
},
{
"uniprot_ac": "Q15751",
"gene_name": "HERC1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q15751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15751"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q15751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15751"
}
]
}
]
},
{
"uniprot_ac": "Q16763",
"gene_name": "UBE2S",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q16763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16763"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q16763",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16763"
}
]
}
]
},
{
"uniprot_ac": "Q2Q1W2",
"gene_name": "TRIM71",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q2Q1W2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q2Q1W2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q2Q1W2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q2Q1W2"
}
]
}
]
},
{
"uniprot_ac": "Q5GLZ8",
"gene_name": "HERC4",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5GLZ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5GLZ8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5GLZ8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5GLZ8"
}
]
}
]
},
{
"uniprot_ac": "Q5T447",
"gene_name": "HECTD3",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5T447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T447"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5T447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T447"
}
]
}
]
},
{
"uniprot_ac": "Q5T4S7",
"gene_name": "UBR4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5T4S7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5T4S7"
}
]
}
]
},
{
"uniprot_ac": "Q5U5Q3",
"gene_name": "MEX3C",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5U5Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5Q3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5U5Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5Q3"
}
]
}
]
},
{
"uniprot_ac": "Q5U5R9",
"gene_name": "HECTD2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5U5R9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5R9"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q5U5R9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5U5R9"
}
]
}
]
},
{
"uniprot_ac": "Q5VTB9",
"gene_name": "RNF220",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5VTB9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VTB9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5VTB9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VTB9"
}
]
}
]
},
{
"uniprot_ac": "Q5VVX9",
"gene_name": "UBE2U",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q5VVX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VVX9"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q5VVX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VVX9"
}
]
}
]
},
{
"uniprot_ac": "Q5XPI4",
"gene_name": "RNF123",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q5XPI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5XPI4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q5XPI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5XPI4"
}
]
}
]
},
{
"uniprot_ac": "Q63HN8",
"gene_name": "RNF213",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q63HN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q63HN8"
}
]
}
]
},
{
"uniprot_ac": "Q6Q0C0",
"gene_name": "TRAF7",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6Q0C0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6Q0C0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6Q0C0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6Q0C0"
}
]
}
]
},
{
"uniprot_ac": "Q6UWE0",
"gene_name": "LRSAM1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6UWE0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6UWE0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6UWE0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6UWE0"
}
]
}
]
},
{
"uniprot_ac": "Q6ZMZ0",
"gene_name": "RNF19B",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q6ZMZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZMZ0"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q6ZMZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZMZ0"
}
]
}
]
},
{
"uniprot_ac": "Q6ZNA4",
"gene_name": "RNF111",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q6ZNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZNA4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q6ZNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZNA4"
}
]
}
]
},
{
"uniprot_ac": "Q712K3",
"gene_name": "UBE2R2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q712K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q712K3"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q712K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q712K3"
}
]
}
]
},
{
"uniprot_ac": "Q7Z3V4",
"gene_name": "UBE3B",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z3V4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z3V4"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z3V4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z3V4"
}
]
}
]
},
{
"uniprot_ac": "Q7Z419",
"gene_name": "RNF144B",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q7Z419",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z419"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q7Z419",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z419"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6E9",
"gene_name": "RBBP6",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6E9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6E9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q7Z6E9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6E9"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6J0",
"gene_name": "SH3RF1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J0"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q7Z6J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J0"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6J8",
"gene_name": "UBE3D",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6J8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z6J8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6J8"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6Z7",
"gene_name": "HUWE1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
}
]
},
{
"uniprot_ac": "Q7Z7E8",
"gene_name": "UBE2Q1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q7Z7E8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z7E8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q7Z7E8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z7E8"
}
]
}
]
},
{
"uniprot_ac": "Q86WT6",
"gene_name": "TRIM69",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86WT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WT6"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86WT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86WT6"
}
]
}
]
},
{
"uniprot_ac": "Q86XS8",
"gene_name": "RNF130",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86XS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XS8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86XS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XS8"
}
]
}
]
},
{
"uniprot_ac": "Q86XT4",
"gene_name": "TRIM50",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86XT4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XT4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86XT4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86XT4"
}
]
}
]
},
{
"uniprot_ac": "Q86Y13",
"gene_name": "DZIP3",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q86Y13",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86Y13"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q86Y13",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86Y13"
}
]
}
]
},
{
"uniprot_ac": "Q8IUQ4",
"gene_name": "SIAH1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IUQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IUQ4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IUQ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IUQ4"
}
]
}
]
},
{
"uniprot_ac": "Q8IVU3",
"gene_name": "HERC6",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IVU3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IVU3"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q8IVU3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IVU3"
}
]
}
]
},
{
"uniprot_ac": "Q8IWV7",
"gene_name": "UBR1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IWV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IWV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV7"
}
]
}
]
},
{
"uniprot_ac": "Q8IWV8",
"gene_name": "UBR2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IWV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8IWV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IWV8"
}
]
}
]
},
{
"uniprot_ac": "Q8IYU2",
"gene_name": "HACE1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8IYU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IYU2"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q8IYU2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IYU2"
}
]
}
]
},
{
"uniprot_ac": "Q8N2K1",
"gene_name": "UBE2J2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q8N2K1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N2K1"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q8N2K1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N2K1"
}
]
}
]
},
{
"uniprot_ac": "Q8N6D2",
"gene_name": "RNF182",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8N6D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N6D2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8N6D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N6D2"
}
]
}
]
},
{
"uniprot_ac": "Q8N7E2",
"gene_name": "CBLL2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8N7E2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N7E2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8N7E2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N7E2"
}
]
}
]
},
{
"uniprot_ac": "Q8ND25",
"gene_name": "ZNRF1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8ND25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8ND25"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8ND25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8ND25"
}
]
}
]
},
{
"uniprot_ac": "Q8NG27",
"gene_name": "PJA1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8NG27",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NG27"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8NG27",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NG27"
}
]
}
]
},
{
"uniprot_ac": "Q8NHG8",
"gene_name": "ZNRF2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8NHG8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHG8"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8NHG8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHG8"
}
]
}
]
},
{
"uniprot_ac": "Q8NHY2",
"gene_name": "COP1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8NHY2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHY2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8NHY2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NHY2"
}
]
}
]
},
{
"uniprot_ac": "Q8TBB1",
"gene_name": "LNX1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8TBB1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBB1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8TBB1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBB1"
}
]
}
]
},
{
"uniprot_ac": "Q8TBC4",
"gene_name": "UBA3",
"activity": [
{
"ec_number": "6.2.1.64",
"activity": "ATP + [NEDD8 protein] + [E1 NEDD8-activating enzyme]-L-cysteine = AMP + diphosphate + [E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine.",
"evidence": [
{
"id": "Q8TBC4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBC4"
}
]
},
{
"ec_number": "6.2.1.64",
"activity": "",
"evidence": [
{
"id": "Q8TBC4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TBC4"
}
]
}
]
},
{
"uniprot_ac": "Q8TC41",
"gene_name": "RNF217",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q8TC41",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TC41"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q8TC41",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TC41"
}
]
}
]
},
{
"uniprot_ac": "Q8TDB6",
"gene_name": "DTX3L",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8TDB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TDB6"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8TDB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TDB6"
}
]
}
]
},
{
"uniprot_ac": "Q8WV44",
"gene_name": "TRIM41",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WV44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WV44"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WV44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WV44"
}
]
}
]
},
{
"uniprot_ac": "Q8WVD3",
"gene_name": "RNF138",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WVD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVD3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WVD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVD3"
}
]
}
]
},
{
"uniprot_ac": "Q8WVN8",
"gene_name": "UBE2Q2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q8WVN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVN8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q8WVN8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVN8"
}
]
}
]
},
{
"uniprot_ac": "Q8WY64",
"gene_name": "MYLIP",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q8WY64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WY64"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q8WY64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WY64"
}
]
}
]
},
{
"uniprot_ac": "Q969K3",
"gene_name": "RNF34",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q969K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969K3"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q969K3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969K3"
}
]
}
]
},
{
"uniprot_ac": "Q969M7",
"gene_name": "UBE2F",
"activity": [
{
"ec_number": "2.3.2.32",
"activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.",
"evidence": [
{
"id": "Q969M7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969M7"
}
]
},
{
"ec_number": "2.3.2.32",
"activity": "",
"evidence": [
{
"id": "Q969M7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969M7"
}
]
}
]
},
{
"uniprot_ac": "Q969Q1",
"gene_name": "TRIM63",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q969Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969Q1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q969Q1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969Q1"
}
]
}
]
},
{
"uniprot_ac": "Q969T4",
"gene_name": "UBE2E3",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q969T4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969T4"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q969T4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q969T4"
}
]
}
]
},
{
"uniprot_ac": "Q96AX9",
"gene_name": "MIB2",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96AX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AX9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96AX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AX9"
}
]
}
]
},
{
"uniprot_ac": "Q96B02",
"gene_name": "UBE2W",
"activity": [
{
"ec_number": "2.3.2.25",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-N-terminal-amino acid = [E1 ubiquitin-activating enzyme]-L-cysteine + N-terminal-ubiquitinyl-[acceptor protein].",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q96B02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96B02"
}
]
}
]
},
{
"uniprot_ac": "Q96BH1",
"gene_name": "RNF25",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96BH1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BH1"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96BH1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BH1"
}
]
}
]
},
{
"uniprot_ac": "Q96F44",
"gene_name": "TRIM11",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96F44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96F44"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96F44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96F44"
}
]
}
]
},
{
"uniprot_ac": "Q96J02",
"gene_name": "ITCH",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96J02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96J02"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q96J02",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96J02"
}
]
}
]
},
{
"uniprot_ac": "Q96LR5",
"gene_name": "UBE2E2",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q96LR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96LR5"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q96LR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96LR5"
}
]
}
]
},
{
"uniprot_ac": "Q96PM5",
"gene_name": "RCHY1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96PM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PM5"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q96PM5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PM5"
}
]
}
]
},
{
"uniprot_ac": "Q96PU5",
"gene_name": "NEDD4L",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.36",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
},
{
"ec_number": "2.3.2.36",
"activity": "",
"evidence": [
{
"id": "Q96PU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96PU5"
}
]
}
]
},
{
"uniprot_ac": "Q99558",
"gene_name": "MAP3K14",
"activity": [
{
"ec_number": "2.7.11.25",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q99558",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99558"
}
]
},
{
"ec_number": "2.7.11.25",
"activity": "",
"evidence": [
{
"id": "Q99558",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99558"
}
]
}
]
},
{
"uniprot_ac": "Q9BV68",
"gene_name": "RNF126",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9BV68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BV68"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9BV68",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BV68"
}
]
}
]
},
{
"uniprot_ac": "Q9BWF2",
"gene_name": "TRAIP",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9BWF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BWF2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9BWF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BWF2"
}
]
}
]
},
{
"uniprot_ac": "Q9BYM8",
"gene_name": "RBCK1",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9BYM8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYM8"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9BYM8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BYM8"
}
]
}
]
},
{
"uniprot_ac": "Q9C026",
"gene_name": "TRIM9",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C026",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C026"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9C026",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C026"
}
]
}
]
},
{
"uniprot_ac": "Q9C037",
"gene_name": "TRIM4",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C037",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C037"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9C037",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C037"
}
]
}
]
},
{
"uniprot_ac": "Q9C0C9",
"gene_name": "UBE2O",
"activity": [
{
"ec_number": "2.3.2.24",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9C0C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C0C9"
}
]
},
{
"ec_number": "2.3.2.24",
"activity": "",
"evidence": [
{
"id": "Q9C0C9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9C0C9"
}
]
}
]
},
{
"uniprot_ac": "Q9H0M0",
"gene_name": "WWP1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9H0M0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H0M0"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9H0M0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H0M0"
}
]
}
]
},
{
"uniprot_ac": "Q9H4P4",
"gene_name": "RNF41",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9H4P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4P4"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9H4P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4P4"
}
]
}
]
},
{
"uniprot_ac": "Q9H832",
"gene_name": "UBE2Z",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9H832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H832"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9H832",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H832"
}
]
}
]
},
{
"uniprot_ac": "Q9H9P5",
"gene_name": "UNKL",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q9H9P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H9P5"
}
]
}
]
},
{
"uniprot_ac": "Q9HAU4",
"gene_name": "SMURF2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HAU4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAU4"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9HAU4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HAU4"
}
]
}
]
},
{
"uniprot_ac": "Q9HCE7",
"gene_name": "SMURF1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HCE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCE7"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9HCE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCE7"
}
]
}
]
},
{
"uniprot_ac": "Q9HCM9",
"gene_name": "TRIM39",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9HCM9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCM9"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9HCM9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCM9"
}
]
}
]
},
{
"uniprot_ac": "Q9NQ86",
"gene_name": "TRIM36",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9NQ86",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQ86"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9NQ86",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQ86"
}
]
}
]
},
{
"uniprot_ac": "Q9NV58",
"gene_name": "RNF19A",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9NV58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NV58"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9NV58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NV58"
}
]
}
]
},
{
"uniprot_ac": "Q9NVW2",
"gene_name": "RLIM",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9NVW2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NVW2"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9NVW2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NVW2"
}
]
}
]
},
{
"uniprot_ac": "Q9P2P5",
"gene_name": "HECW2",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9P2P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P2P5"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9P2P5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P2P5"
}
]
}
]
},
{
"uniprot_ac": "Q9UBS8",
"gene_name": "RNF14",
"activity": [
{
"ec_number": "2.3.2.31",
"activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.",
"evidence": [
{
"id": "Q9UBS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBS8"
}
]
},
{
"ec_number": "2.3.2.31",
"activity": "",
"evidence": [
{
"id": "Q9UBS8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBS8"
}
]
}
]
},
{
"uniprot_ac": "Q9UHC7",
"gene_name": "MKRN1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9UHC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UHC7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9UHC7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UHC7"
}
]
}
]
},
{
"uniprot_ac": "Q9UII4",
"gene_name": "HERC5",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "Q9UII4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UII4"
}
]
}
]
},
{
"uniprot_ac": "Q9ULT8",
"gene_name": "HECTD1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9ULT8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULT8"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q9ULT8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULT8"
}
]
}
]
},
{
"uniprot_ac": "Q9UNE7",
"gene_name": "STUB1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9UNE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNE7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9UNE7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNE7"
}
]
}
]
},
{
"uniprot_ac": "Q9Y252",
"gene_name": "RNF6",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y252"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y252"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2X8",
"gene_name": "UBE2D4",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9Y2X8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2X8"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9Y2X8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2X8"
}
]
}
]
},
{
"uniprot_ac": "Q9Y385",
"gene_name": "UBE2J1",
"activity": [
{
"ec_number": "2.3.2.23",
"activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.",
"evidence": [
{
"id": "Q9Y385",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y385"
}
]
},
{
"ec_number": "2.3.2.23",
"activity": "",
"evidence": [
{
"id": "Q9Y385",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y385"
}
]
}
]
},
{
"uniprot_ac": "Q9Y4B6",
"gene_name": "DCAF1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9Y4B6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4B6"
}
]
}
]
},
{
"uniprot_ac": "Q9Y4L5",
"gene_name": "RNF115",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y4L5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4L5"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y4L5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y4L5"
}
]
}
]
},
{
"uniprot_ac": "Q9Y508",
"gene_name": "RNF114",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9Y508",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y508"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9Y508",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y508"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 182
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}