{ "uniprot_canonical_ac": "P60041-1", "uniprot_ac": "P60041", "uniprot_id": "SMS_MOUSE", "mass": { "chemical_mass": 12746.0, "monoisotopic_mass": 12746.0 }, "refseq": { "ac": "NP_033241", "name": "somatostatin precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241" }, "gene_names": [ { "name": "Sst", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P60041", "id": "P60041" }, { "name": "Smst; SOM; SRIF; SS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241", "id": "NP_033241" }, { "name": "Smst", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P60041", "id": "P60041" }, { "name": "Sst", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241", "id": "NP_033241" } ], "protein_names": [ { "name": "Somatostatin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P60041" }, { "name": "preprosomatostatin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241", "id": "NP_033241" }, { "name": "somatostatin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241", "id": "NP_033241" } ], "function": [ { "annotation": "Beta cell primary cilia mediate somatostatin responsiveness via SSTR3.", "evidence": [ { "database": "RefSeq", "id": "NP_033241", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241" }, { "database": "PubMed", "id": "37660302", "url": "https://glygen.org/publication/PubMed/37660302" } ] }, { "annotation": "Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041#function" }, { "database": "UniProtKB", "id": "P61278", "url": "https://www.uniprot.org/uniprot/P61278#function" } ] }, { "annotation": "May enhance low-glucose-induced glucagon release by pancreatic alpha cells (PubMed:24735892). This effect may be mediated by binding to GPR107 and PKA activation (PubMed:26561648). May regulate cardiac contractile function (PubMed:25012062). May compromise cardiomyocyte viability (By similarity). In the central nervous system, may impair memory retention and may affect hippocampal excitability (By similarity). May also have anxiolytic and anorexigenic effects (By similarity). May play a role in arterial pressure regulation (By similarity). May inhibit basal, but not ghrelin- or GnRH-stimulated secretion of GH1 or LH, but does not affect the release of other pituitary hormones, including PRL, ACTH, FSH or TSH (By similarity). Potentiates inhibitory action of somatostatin on ghrelin-stimulated secretion of GH1, but not that on GnRH-stimulated secretion of LH (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041#function" }, { "database": "UniProtKB", "id": "P61278", "url": "https://www.uniprot.org/uniprot/P61278#function" }, { "database": "PubMed", "id": "24735892", "url": "https://glygen.org/publication/PubMed/24735892" }, { "database": "PubMed", "id": "25012062", "url": "https://glygen.org/publication/PubMed/25012062" }, { "database": "PubMed", "id": "26561648", "url": "https://glygen.org/publication/PubMed/26561648" }, { "database": "UniProtKB", "id": "P60042", "url": "https://www.uniprot.org/uniprot/P60042#function" } ] } ], "disease": [ { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:10808", "recommended_name": { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "gastric ulcer", "description": "" }, "synonyms": [ { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "chronic gastric ulcer without hemorrhage AND without perforation but with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer without hemorrhage, without perforation AND without obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage and obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with perforation, with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with perforation", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "bleeding acute gastric ulcer", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage AND with perforation but without obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "chronic gastric ulcer without hemorrhage AND without perforation", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer without mention of hemorrhage or perforation, without mention of obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage, with perforation AND with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with perforation AND obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage, with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage and perforation, without mention of obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage and perforation", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "chronic gastric ulcer without mention of hemorrhage or perforation, with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with hemorrhage and perforation, with obstruction", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer without hemorrhage and without perforation", "description": "" }, { "id": "DOID:10808", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10808", "name": "acute gastric ulcer with haemorrhage and perforation", "description": "" } ], "evidence": [ { "id": "10808", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10808" } ] }, { "disease_id": "DOID:8725", "recommended_name": { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "vascular dementia", "description": "A dementia that involves impairments in cognitive function caused by problems in blood vessels that feed the brain." }, "synonyms": [ { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "Multi Infarct Dementia", "description": "" }, { "id": "DOID:8725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8725", "name": "multifocal dementia", "description": "" } ], "evidence": [ { "id": "8725", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8725" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Sst", "url": "https://www.uniprot.org/uniprot/P60041", "locus": { "chromosome": "16", "start_pos": 23708323, "end_pos": 23709708, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000004366", "url": "https://www.ensembl.org/id/ENSMUSG00000004366" } ] } } ], "crossref": [ { "id": "ENSMUSG00000004366", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000004366", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "20604", "url": "https://www.ncbi.nlm.nih.gov/gene/20604", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004250", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004250", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018142", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018142", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:20604", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20604", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "98326", "url": "http://www.informatics.jax.org/marker/MGI:98326", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "AEQDDMR", "url": "https://omabrowser.org/oma/group/AEQDDMR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358664at2759", "url": "http://www.orthodb.org/?query=5358664at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10558", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10558", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10558:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10558:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03002", "url": "http://pfam.xfam.org/family/PF03002", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P60041", "url": "http://purl.obolibrary.org/obo/PR_P60041", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_033241", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P60041-1", "url": "https://www.uniprot.org/uniprot/P60041-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC", "length": 116, "header": "sp|P60041-1|SMS_MOUSE Isoform 1 of Somatostatin OS=Mus musculus OX=10090 GN=Sst PE=1 SV=1 CANONICAL=P60041-1" }, "isoforms": [ { "isoform_ac": "P60041-1", "url": "", "sequence": { "sequence": "MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC", "length": 116, "header": "sp|P60041-1|SMS_MOUSE Isoform 1 of Somatostatin OS=Mus musculus OX=10090 GN=Sst PE=1 SV=1 CANONICAL=P60041-1" }, "locus": { "chromosome": "16", "start_pos": 23709494, "end_pos": 23708482, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000004480", "url": "https://www.ensembl.org/id/ENSMUST00000004480" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000004480", "url": "https://www.ensembl.org/id/ENSMUSP00000004480" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Neuronostatin encoded by the somatostatin gene regulates neuronal, cardiovascular, and metabolic functions.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Yang J., Klein C., Samson W.K., Cui K., Wang Y.X., Hsueh A.J., Chen X.Q., Avsian-Kretchmer O., Yuan X.B., Zhang J.V., Chang J.K., Yosten G.L., Ferguson A.V., Hoyda T.D., Lyu R.M., Price C.J.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "reference": [ { "type": "PubMed", "id": "18753129", "url": "https://glygen.org/publication/PubMed/18753129" } ] }, { "title": "Nucleotide sequence of the mouse preprosomatostatin gene.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Heilig R., Kempf J., Fuhrmann G., Ebel A.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "reference": [ { "type": "PubMed", "id": "1969620", "url": "https://glygen.org/publication/PubMed/1969620" } ] }, { "title": "Neuronostatin inhibits glucose-stimulated insulin secretion via direct action on the pancreatic alpha-cell.", "journal": "Am. J. Physiol.", "date": "2014", "authors": "Samson W.K., Corbett J.A., Yosten G.L., Elrick M.M., Salvatori A.S.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "reference": [ { "type": "PubMed", "id": "24735892", "url": "https://glygen.org/publication/PubMed/24735892" } ] }, { "title": "Neuronostatin attenuates myocardial contractile function through inhibition of sarcoplasmic reticulum Ca2+-ATPase in murine heart.", "journal": "Cell. Physiol. Biochem.", "date": "2014", "authors": "Chen X., Xu X., Zhu X., Hu N., Samson W.K., Dong H., Luo F., Xiong L., Nair S., Hua Y., Zhu M.Z.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "reference": [ { "type": "PubMed", "id": "25012062", "url": "https://glygen.org/publication/PubMed/25012062" } ] }, { "title": "Neuronostatin acts via GPR107 to increase cAMP-independent PKA phosphorylation and proglucagon mRNA accumulation in pancreatic alpha-cells.", "journal": "Am. J. Physiol.", "date": "2016", "authors": "Elrick MM, Samson WK, Corbett JA, Salvatori AS, Stein LM, Kolar GR, Naatz A, Yosten GL", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "reference": [ { "type": "PubMed", "id": "26561648", "url": "https://glygen.org/publication/PubMed/26561648" } ] }, { "title": "Beta cell primary cilia mediate somatostatin responsiveness via SSTR3.", "journal": "Islets", "date": "2023-12-31", "authors": "Adamson Samantha E, Li Zipeng A, Hughes Jing W", "evidence": [ { "database": "RefSeq", "id": "NP_033241", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033241" } ], "reference": [ { "type": "PubMed", "id": "37660302", "url": "https://glygen.org/publication/PubMed/37660302" } ] } ], "pathway": [ { "id": "mmu:20604", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20604", "resource": "KEGG Pathway" }, { "id": "R-MMU-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P60042-1", "protein_name": "Somatostatin", "gene_name": "Sst", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC", "length": 116 }, "evidence": [ { "id": "45225400", "url": "http://www.informatics.jax.org/homology/45225400", "database": "MGI" }, { "id": "P60041", "url": "https://omabrowser.org/oma/group/P60041/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P61278-1", "protein_name": "Somatostatin", "gene_name": "SST", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC", "length": 116 }, "evidence": [ { "id": "45225400", "url": "http://www.informatics.jax.org/homology/45225400", "database": "MGI" }, { "id": "P60041", "url": "https://omabrowser.org/oma/group/P60041/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "GABA-ergic synapse", "id": "GO:0098982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098982", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "neuronal dense core vesicle", "id": "GO:0098992", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098992", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "response to steroid hormone", "id": "GO:0048545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048545", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "regulation of cell migration", "id": "GO:0030334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030334", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "response to acidic pH", "id": "GO:0010447", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010447", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "response to amino acid", "id": "GO:0043200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043200", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "hyperosmotic response", "id": "GO:0006972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006972", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" }, { "name": "regulation of postsynaptic membrane neurotransmitter receptor levels", "id": "GO:0099072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099072", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "C-terminal amidation of the neuronostatin peptide is required for its biological activity, including for the regulation of mean arterial pressure.", "evidence": [ { "database": "UniProtKB", "id": "P60041", "url": "https://www.uniprot.org/uniprot/P60041" }, { "database": "PubMed", "id": "P60042", "url": "https://glygen.org/publication/PubMed/P60042" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }