{ "uniprot_canonical_ac": "P59110-1", "uniprot_ac": "P59110", "uniprot_id": "SENP1_MOUSE", "mass": { "chemical_mass": 72511.0, "monoisotopic_mass": 72511.0 }, "refseq": { "ac": "XP_006520945", "name": "sentrin-specific protease 1 isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520945" }, "gene_names": [ { "name": "Senp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P59110", "id": "P59110" }, { "name": "2310046A20Rik; D15Ertd528e; E330036L07Rik; suPr-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520945", "id": "XP_006520945" }, { "name": "Senp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520945", "id": "XP_006520945" }, { "name": "Supr2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P59110", "id": "P59110" } ], "protein_names": [ { "name": "Sentrin-specific protease 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P59110" }, { "name": "3.4.22.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P59110" }, { "name": "SUMO-1 protease 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P59110" }, { "name": "SUMO1/sentrin specific protease 1; sentrin-specific protease 1; SUMO-1 protease 2; sentrin/SUMO-specific protease SENP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100", "id": "NP_659100" }, { "name": "Sentrin/SUMO-specific protease SENP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P59110" }, { "name": "SuPr-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P59110" }, { "name": "sentrin-specific protease 1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100", "id": "NP_659100" }, { "name": "sentrin-specific protease 1 isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006520945", "id": "XP_006520945" } ], "function": [ { "annotation": "Data describe a mutation in SENP1 that causes increased steady-state levels of the sumoylated forms of a number of proteins and results in placental abnormalities incompatible with embryonic development.", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "15923632", "url": "https://glygen.org/publication/PubMed/15923632" } ] }, { "annotation": "FSTL1 promotes alveolar epithelial cell aging and worsens pulmonary fibrosis by affecting SENP1-mediated DeSUMOylation.", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "37369969", "url": "https://glygen.org/publication/PubMed/37369969" } ] }, { "annotation": "Leptin accelerates BMSC transformation into vertebral epiphyseal plate chondrocytes by activating SENP1-mediated deSUMOylation of SIRT3.", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "36537765", "url": "https://glygen.org/publication/PubMed/36537765" } ] }, { "annotation": "Protease that catalyzes two essential functions in the SUMO pathway (PubMed:15923632, PubMed:29499132). The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins. The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. Deconjugates SUMO1 from HIPK2 (By similarity). Deconjugates SUMO1 from HDAC1 and BHLHE40/DEC1, which decreases its transcriptional repression activity (By similarity). Deconjugates SUMO1 from CLOCK, which decreases its transcriptional activation activity (By similarity). Deconjugates SUMO2 from MTA1 (By similarity). Deconjugates SUMO2 from MTA1 (By similarity). Deconjugates SUMO1 from METTL3 (By similarity). Desumoylates CCAR2 which decreases its interaction with SIRT1 (By similarity). Deconjugates SUMO1 from GPS2 (PubMed:29499132).", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110#function" }, { "database": "UniProtKB", "id": "Q9P0U3", "url": "https://www.uniprot.org/uniprot/Q9P0U3#function" }, { "database": "PubMed", "id": "15923632", "url": "https://glygen.org/publication/PubMed/15923632" }, { "database": "PubMed", "id": "29499132", "url": "https://glygen.org/publication/PubMed/29499132" } ] }, { "annotation": "SENP1 modulates chronic intermittent hypoxia-induced inflammation of microglia and neuronal injury by inhibiting TOM1 pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "37137262", "url": "https://glygen.org/publication/PubMed/37137262" } ] }, { "annotation": "SENP1 prevents steatohepatitis by suppressing RIPK1-driven apoptosis and inflammation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "36414671", "url": "https://glygen.org/publication/PubMed/36414671" } ] }, { "annotation": "Transcription factor YY1 mediates self-renewal of glioblastoma stem cells through regulation of the SENP1/METTL3/MYC axis.", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" }, { "database": "PubMed", "id": "36575317", "url": "https://glygen.org/publication/PubMed/36575317" } ] } ], "disease": [ { "disease_id": "DOID:9744", "recommended_name": { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "type 1 diabetes mellitus", "description": "A diabetes mellitus that is characterized by destruction of pancreatic beta cells resulting in absent or extremely low insulin production." }, "synonyms": [ { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "IDDM", "description": "" }, { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "type I diabetes mellitus", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type 1 diabetes mellitus", "description": "A chronic condition characterized by minimal or absent production of insulin by the pancreas." }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "IDDM", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "diabetes mellitis type 1", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "diabetes mellitis type I", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "immune mediated diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "juvenile diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type 1 diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type I diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type I diabetes mellitus", "description": "" }, { "id": "MIM:222100", "resource": "MIM", "url": "https://www.omim.org/entry/222100", "name": "Type 1 diabetes mellitus", "description": "Type 1 diabetes mellitus" } ], "evidence": [ { "id": "9744", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9744" } ] } ], "snv": [ { "evidence": [ { "id": "rs3389349264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389349264" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 258, "end_pos": 258, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (ILT->NLT).", "chr_id": "15", "chr_pos": "97964440", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I258", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Senp1", "url": "https://www.uniprot.org/uniprot/P59110", "locus": { "chromosome": "15", "start_pos": 97936625, "end_pos": 97991625, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000033075", "url": "https://www.ensembl.org/id/ENSMUSG00000033075" } ] } } ], "crossref": [ { "id": "ENSMUSG00000033075", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000033075", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.4.22.B70", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.22.B70&UniProtAcc=P59110", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "223870", "url": "https://www.ncbi.nlm.nih.gov/gene/223870", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P59110", "url": "https://www.ebi.ac.uk/intact/interactors/id:P59110*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003653", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003653", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:223870", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:223870", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2445054", "url": "http://www.informatics.jax.org/marker/MGI:2445054", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P59110", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P59110", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FPEITEX", "url": "https://omabrowser.org/oma/group/FPEITEX/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1068193at2759", "url": "http://www.orthodb.org/?query=1068193at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12606", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12606", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12606:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12606:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02902", "url": "http://pfam.xfam.org/family/PF02902", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P59110", "url": "http://purl.obolibrary.org/obo/PR_P59110", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-3065679", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3065679", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9035034", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9035034", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "M0QWV7", "url": "https://www.uniprot.org/uniprot/M0QWV7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QWV7-1", "url": "https://www.uniprot.org/uniprot/M0QWV7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QWX4", "url": "https://www.uniprot.org/uniprot/M0QWX4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QWX4-1", "url": "https://www.uniprot.org/uniprot/M0QWX4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P59110-1", "url": "https://www.uniprot.org/uniprot/P59110-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1V9", "url": "https://www.uniprot.org/uniprot/S4R1V9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1V9-1", "url": "https://www.uniprot.org/uniprot/S4R1V9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSFTCSTRSPAYRPDYHSDNPSSDSFLGSGDVRTFGQSANGQWRNSTPASGSAPQKPRNSRSLCLETRKTSSGLSNTFVGKSNHHCHMSAYEKSFPIKPAPSPSWSGSCRRSLLSPKKTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFCVAKPTTHFPLRLSRCLSSNKNSLKDSLLRNGNSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAAPHQPNSLPASNTQSEGSDSVILLKVKESQTPASSPTFFQAELWIKELTSVYDSRARERLRRIEEQKALALQLQNQRLQEQEHAVLDSVELHLRVPLEKEIPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGFPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL", "length": 640, "header": "sp|P59110-1|SENP1_MOUSE Isoform 1 of Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1 CANONICAL=P59110-1" }, "isoforms": [ { "isoform_ac": "M0QWV7-1", "url": "", "sequence": { "sequence": "MDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSFTCSTRSPAYRPDYHSGPGLGVLARYSWGKMLTFGGHHGVTLMQIRHMAVAGFSSFINFQITLPQTVSLAQVT", "length": 130, "header": "tr|M0QWV7-1|SENP1_MOUSE Computationally mapped isoform of Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1 CANONICAL=P59110-1" }, "locus": { "chromosome": "15", "start_pos": 97984970, "end_pos": 97974552, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000180716.8", "url": "https://www.ensembl.org/id/ENSMUST00000180716.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138032.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138032.2" } ] } }, { "isoform_ac": "M0QWX4-1", "url": "", "sequence": { "sequence": "MDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSFTCSTRSPAYRPDYHSDNPSSDSFLGSGDVRTFGQSANGQWRNSTPASGSAPQKPRNSRSLCLETRKTSSGLSNTFVGKSNHHCHMSAYEKSFPIKPAPSPSWSGSCRRSLLSPKKTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFCVAKPTTHFPLRLSRCLSSNKNSLKDSLLRNGNSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAAPHQPNSLPASNTQSEGSDSVILLKVKESQTPASRYLSPLKRRSCPYIIPYSAVMDLLSSSPTFFQAELWIKELTSVYDSRARERLRRIEEQKALALQLQNQRLQEQEHAVLDSVELHLRVPLEKEIPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGFPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL", "length": 666, "header": "tr|M0QWX4-1|SENP1_MOUSE Computationally mapped isoform of Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1 CANONICAL=P59110-1" }, "locus": { "chromosome": "15", "start_pos": 97984970, "end_pos": 97940774, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000180657.2", "url": "https://www.ensembl.org/id/ENSMUST00000180657.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138056.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138056.2" } ] } }, { "isoform_ac": "P59110-1", "url": "", "sequence": { "sequence": "MDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSFTCSTRSPAYRPDYHSDNPSSDSFLGSGDVRTFGQSANGQWRNSTPASGSAPQKPRNSRSLCLETRKTSSGLSNTFVGKSNHHCHMSAYEKSFPIKPAPSPSWSGSCRRSLLSPKKTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFCVAKPTTHFPLRLSRCLSSNKNSLKDSLLRNGNSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAAPHQPNSLPASNTQSEGSDSVILLKVKESQTPASSPTFFQAELWIKELTSVYDSRARERLRRIEEQKALALQLQNQRLQEQEHAVLDSVELHLRVPLEKEIPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGFPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL", "length": 640, "header": "sp|P59110-1|SENP1_MOUSE Isoform 1 of Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1 CANONICAL=P59110-1" }, "locus": { "chromosome": "15", "start_pos": 97984970, "end_pos": 97940774, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000044189", "url": "https://www.ensembl.org/id/ENSMUST00000044189" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000046598", "url": "https://www.ensembl.org/id/ENSMUSP00000046598" } ] } }, { "isoform_ac": "S4R1V9-1", "url": "", "sequence": { "sequence": "MDDTADGVKMDAGEVTLVNHG", "length": 21, "header": "tr|S4R1V9-1|S4R1V9_MOUSE Computationally mapped isoform of SUMO1/sentrin specific peptidase 1 OS=Mus musculus OX=10090 GN=Senp1 PE=4 SV=1 CANONICAL=P59110-1" }, "locus": { "chromosome": "15", "start_pos": 97984970, "end_pos": 97982923, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000183105.2", "url": "https://www.ensembl.org/id/ENSMUST00000183105.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138394.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138394.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 397, "start_aa": "Thr", "end_pos": 397, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr397", "evidence": [ { "id": "P59110", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P59110" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "phosphorylation": [ { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "site_lbl": "Ser117" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "site_lbl": "Ser157" }, { "start_pos": 57, "end_pos": 57, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "site_lbl": "Ser57" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Mutation of SENP1/SuPr-2 reveals an essential role for desumoylation in mouse development.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Yamaguchi T, Sharma P, Athanasiou M, Kumar A, Yamada S, Kuehn MR", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" }, { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "15923632", "url": "https://glygen.org/publication/PubMed/15923632" } ] }, { "title": "Mitochondrial retrograde signaling in mammals is mediated by the transcriptional cofactor GPS2 via direct mitochondria-to-nucleus translocation.", "journal": "Mol. Cell", "date": "2018", "authors": "Cardamone MD, Tanasa B, Cederquist CT, Huang J, Mahdaviani K, Li W, Rosenfeld MG, Liesa M, Perissi V", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "reference": [ { "type": "PubMed", "id": "29499132", "url": "https://glygen.org/publication/PubMed/29499132" } ] }, { "title": "SENP1 prevents steatohepatitis by suppressing RIPK1-driven apoptosis and inflammation.", "journal": "Nature communications", "date": "2022-11-22", "authors": "Yan Lingjie, Zhang Tao, Wang Kai, Chen Zezhao, Yang Yuanxin, Shan Bing, Sun Qi, Zhang Mengmeng, Zhang Yichi, Zhong Yedan, Liu Nan, Gu Jinyang, Xu Daichao", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "36414671", "url": "https://glygen.org/publication/PubMed/36414671" } ] }, { "title": "Leptin accelerates BMSC transformation into vertebral epiphyseal plate chondrocytes by activating SENP1-mediated deSUMOylation of SIRT3.", "journal": "FEBS open bio", "date": "2022-12-20", "authors": "Li Xiaomiao, Fu Xiaodong, Li Hao, Gao Yingjian, Wang Weili, Liu Zude, Shen Yi", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "36537765", "url": "https://glygen.org/publication/PubMed/36537765" } ] }, { "title": "Transcription factor YY1 mediates self-renewal of glioblastoma stem cells through regulation of the SENP1/METTL3/MYC axis.", "journal": "Cancer gene therapy", "date": "2022-12-27", "authors": "You Jian, Tao Bei, Peng Lilei, Peng Tangming, He Haiping, Zeng Shan, Han Jizhong, Chen Ligang, Xia Xiangguo, Yang Xiaobo, Zhong Chuanhong", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "36575317", "url": "https://glygen.org/publication/PubMed/36575317" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P59110", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P59110" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] }, { "title": "SENP1 modulates chronic intermittent hypoxia-induced inflammation of microglia and neuronal injury by inhibiting TOM1 pathway.", "journal": "International immunopharmacology", "date": "2023-05-01", "authors": "Wang Hongwei, Wang Xu, Shen Yubin, Wang Yanmin, Yang Tianyun, Sun Jinyuan, Liu Song", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "37137262", "url": "https://glygen.org/publication/PubMed/37137262" } ] }, { "title": "FSTL1 promotes alveolar epithelial cell aging and worsens pulmonary fibrosis by affecting SENP1-mediated DeSUMOylation.", "journal": "Cell biology international", "date": "2023-10", "authors": "Sun Wei, Yang Xiaoyu, Chen Lijuan, Guo Lu, Huang Hui, Liu Xiaoshu, Yang Yang, Xu Zuojun", "evidence": [ { "database": "RefSeq", "id": "NP_659100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_659100" } ], "reference": [ { "type": "PubMed", "id": "37369969", "url": "https://glygen.org/publication/PubMed/37369969" } ] } ], "pathway": [ { "id": "mmu:223870", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:223870", "resource": "KEGG Pathway" }, { "id": "R-MMU-3065679", "name": "SUMO is proteolytically processed", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3065679", "resource": "Reactome", "description": "SUMO is proteolytically processed" }, { "id": "R-MMU-9035034", "name": "RHOF GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9035034", "resource": "Reactome", "description": "RHOF GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "F1LVT6-1", "protein_name": "SUMO specific peptidase 1", "gene_name": "Senp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWSLSLEDTADGVKMDAGEVTLVNHSSAFRAHLLPHSGFPEDQLALSDQQILPFRQGTLHRAFTGSTSSAAYNPDYHSDNPSSDSFLGSGDIRTFGQSANGQWRNSTPASGSALQKPRNSRSLYLETRKTSSGLSNTFVGKSNHHCHVSAYEKSFPIKPAPSPSWSGSCRRSLLSPKKTQRRHFSTAEETVQEEEKEIYRQLLQMVTGKQFSVAKPTTHFPLHLSRCLSSNKNSLKDSLLRNGNSCASHVIGSDTSSSGSASILTAQEQLSHSAHSLISGTPDVAFGSKDSALHHHLSAPHQPDSLPASNPQSEGSDSVILLKVKESQTPASSPTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEQEHAVLDSVELHLRVPLEKEVPVTAAQETRKKSHQLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGFPSVHAFNTFFFTKLKAAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKSVTYYDSMGGVNNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL", "length": 645 }, "evidence": [ { "id": "45239848", "url": "http://www.informatics.jax.org/homology/45239848", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9P0U3-1", "protein_name": "Sentrin-specific protease 1", "gene_name": "SENP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL", "length": 644 }, "evidence": [ { "id": "45239848", "url": "http://www.informatics.jax.org/homology/45239848", "database": "MGI" }, { "id": "P59110", "url": "https://omabrowser.org/oma/group/P59110/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "apoptotic signaling pathway", "id": "GO:0097190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097190", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "protein desumoylation", "id": "GO:0016926", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016926", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "regulation of definitive erythrocyte differentiation", "id": "GO:0010724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010724", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "negative regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032435", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032435", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "cysteine-type peptidase activity", "id": "GO:0008234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008234", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "deSUMOylase activity", "id": "GO:0016929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016929", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" }, { "name": "SUMO-specific endopeptidase activity", "id": "GO:0070139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070139", "evidence": [ { "database": "UniProtKB", "id": "P59110", "url": "https://www.uniprot.org/uniprot/P59110" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" }, { "start_pos": 595, "end_pos": 597, "annotation": "n_glycosylation_sequon" }, { "start_pos": 617, "end_pos": 619, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-2990840", "name": "SENP1,2,5 proteolytically process SUMO1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-MMU-2990831" ], "output_participant_list": [ "R-MMU-877304" ], "enzyme_list": [ "Q91ZX6-1", "P59110-1", "Q6NXL6-1" ], "evidence": [ { "id": "R-MMU-2990840", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2990840" } ] }, { "id": "R-MMU-2990842", "name": "SENP1,2,5 proteolytically process SUMO2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-MMU-2990837" ], "output_participant_list": [ "R-MMU-3214943" ], "enzyme_list": [ "Q91ZX6-1", "P59110-1", "Q6NXL6-1" ], "evidence": [ { "id": "R-MMU-2990842", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2990842" } ] }, { "id": "R-MMU-2993763", "name": "SENP1,2,5 proteolytically process SUMO3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-MMU-2990830" ], "output_participant_list": [ "R-MMU-3730657" ], "enzyme_list": [ "Q91ZX6-1", "P59110-1", "Q6NXL6-1" ], "evidence": [ { "id": "R-MMU-2993763", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2993763" } ] }, { "id": "R-MMU-9693125", "name": "RHOF binds effectors at the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z2C4-1", "Q8CI59-1", "P51150-1", "P63260-1", "P59110-1" ], "evidence": [ { "id": "R-MMU-9693125", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9693125" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-2990830", "participant_name": "Sumo3 [nucleoplasm]", "crossref": [ { "id": "NP_064313.1", "database": "RefSeq", "url": "" }, { "id": "Q9Z172", "database": "UniProt", "url": "" }, { "id": "ENSMUST00000099538", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000020265", "database": "Ensembl", "url": "" }, { "id": "1336201", "database": "MGI", "url": "" }, { "id": "Q9Z172", "database": "PRO", "url": "" }, { "id": "NP_001288602.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUST00000020501", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000020501", "database": "Ensembl", "url": "" }, { "id": "NP_001288601.1", "database": "RefSeq", "url": "" }, { "id": "NP_001288600.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000097136", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-2990831", "participant_name": "Sumo1 [nucleoplasm]", "crossref": [ { "id": "NP_033486.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000026021", "database": "Ensembl", "url": "" }, { "id": "1197010", "database": "MGI", "url": "" }, { "id": "P63166", "database": "PRO", "url": "" }, { "id": "ENSMUST00000091374", "database": "Ensembl", "url": "" }, { "id": "P63166", "database": "UniProt", "url": "" }, { "id": "ENSMUSP00000088935", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-2990837", "participant_name": "Sumo2 [nucleoplasm]", "crossref": [ { "id": "5TVQ", "database": "PDB", "url": "" }, { "id": "ENSMUST00000153892", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000115044", "database": "Ensembl", "url": "" }, { "id": "5TVP", "database": "PDB", "url": "" }, { "id": "P61957", "database": "PRO", "url": "" }, { "id": "NP_579932.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000020738", "database": "Ensembl", "url": "" }, { "id": "P61957", "database": "UniProt", "url": "" }, { "id": "2158813", "database": "MGI", "url": "" } ] }, { "participant_id": "R-MMU-3214943", "participant_name": "Sumo2 [nucleoplasm]", "crossref": [ { "id": "P61957", "database": "UniProt", "url": "" }, { "id": "5TVQ", "database": "PDB", "url": "" }, { "id": "NP_579932.1", "database": "RefSeq", "url": "" }, { "id": "5TVP", "database": "PDB", "url": "" }, { "id": "2158813", "database": "MGI", "url": "" }, { "id": "ENSMUST00000153892", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000020738", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000115044", "database": "Ensembl", "url": "" }, { "id": "P61957", "database": "PRO", "url": "" } ] }, { "participant_id": "R-MMU-3730657", "participant_name": "Sumo3 [nucleoplasm]", "crossref": [ { "id": "Q9Z172", "database": "UniProt", "url": "" }, { "id": "NP_001288601.1", "database": "RefSeq", "url": "" }, { "id": "1336201", "database": "MGI", "url": "" }, { "id": "ENSMUST00000020501", "database": "Ensembl", "url": "" }, { "id": "NP_064313.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000097136", "database": "Ensembl", "url": "" }, { "id": "Q9Z172", "database": "PRO", "url": "" }, { "id": "ENSMUSP00000020501", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000099538", "database": "Ensembl", "url": "" }, { "id": "NP_001288600.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000020265", "database": "Ensembl", "url": "" }, { "id": "NP_001288602.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-877304", "participant_name": "Sumo1 [nucleoplasm]", "crossref": [ { "id": "1197010", "database": "MGI", "url": "" }, { "id": "P63166", "database": "PRO", "url": "" }, { "id": "ENSMUSG00000026021", "database": "Ensembl", "url": "" }, { "id": "NP_033486.1", "database": "RefSeq", "url": "" }, { "id": "P63166", "database": "UniProt", "url": "" }, { "id": "ENSMUST00000091374", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000088935", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P59110", "gene_name": "Senp1", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "P59110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59110" } ] } ] }, { "uniprot_ac": "P63260", "gene_name": "Actg1", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P63260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63260" } ] } ] }, { "uniprot_ac": "Q6NXL6", "gene_name": "Senp5", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q6NXL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NXL6" } ] } ] }, { "uniprot_ac": "Q8CI59", "gene_name": "Steap3", "activity": [ { "ec_number": "1.16.1.-", "activity": "", "evidence": [ { "id": "Q8CI59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CI59" } ] } ] }, { "uniprot_ac": "Q91ZX6", "gene_name": "Senp2", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q91ZX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZX6" } ] } ] }, { "uniprot_ac": "Q9Z2C4", "gene_name": "Mtmr1", "activity": [ { "ec_number": "3.1.3.64", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate.", "evidence": [ { "id": "Q9Z2C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2C4" } ] }, { "ec_number": "3.1.3.95", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-5-phosphate) + phosphate.", "evidence": [ { "id": "Q9Z2C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2C4" } ] }, { "ec_number": "3.1.3.64", "activity": "", "evidence": [ { "id": "Q9Z2C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2C4" } ] }, { "ec_number": "3.1.3.95", "activity": "", "evidence": [ { "id": "Q9Z2C4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2C4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }