{ "uniprot_canonical_ac": "P58821-1", "uniprot_ac": "P58821", "uniprot_id": "CALY_RAT", "mass": { "chemical_mass": 24718.0, "monoisotopic_mass": 24718.0 }, "refseq": { "ac": "NP_001177328", "name": "neuron-specific vesicular protein calcyon", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" }, "gene_names": [ { "name": "Caly", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P58821", "id": "P58821" }, { "name": "Calcyon; Drd1ip", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328", "id": "NP_001177328" }, { "name": "Caly", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328", "id": "NP_001177328" }, { "name": "Drd1ip", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P58821", "id": "P58821" } ], "protein_names": [ { "name": "Neuron-specific vesicular protein calcyon", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P58821" }, { "name": "dopamine receptor D1 interacting protein; calcyon; D1 dopamine receptor-interacting protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328", "id": "NP_001177328" }, { "name": "neuron-specific vesicular protein calcyon", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328", "id": "NP_001177328" } ], "function": [ { "annotation": "Calcyon forms a novel ternary complex with dopamine D1 receptor through PSD-95 protein and plays a role in dopamine receptor internalization", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" }, { "database": "PubMed", "id": "22843680", "url": "https://glygen.org/publication/PubMed/22843680" } ] }, { "annotation": "Caly is a multifunctional scaffolding protein that regulates axonal transport of late endosomes and lysosome-related organelles by coordinately interacting with motor and vesicle coat proteins.", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" }, { "database": "PubMed", "id": "29949458", "url": "https://glygen.org/publication/PubMed/29949458" } ] }, { "annotation": "Endocytic and cargo sorting functions of Caly in neurons", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" }, { "database": "PubMed", "id": "28734834", "url": "https://glygen.org/publication/PubMed/28734834" } ] }, { "annotation": "Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821#function" }, { "database": "PubMed", "id": "16595675", "url": "https://glygen.org/publication/PubMed/16595675" } ] } ], "disease": [ { "disease_id": "DOID:1094", "recommended_name": { "id": "DOID:1094", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1094", "name": "attention deficit hyperactivity disorder", "description": "A specific developmental disorder that is characterized by co-existence of attentional problems and hyperactivity, with each behavior occurring infrequently alone and symptoms starting before seven years of age." }, "synonyms": [ { "id": "DOID:1094", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1094", "name": "ADHD", "description": "" }, { "id": "DOID:1094", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1094", "name": "attention deficit disorder", "description": "" }, { "id": "DOID:1094", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1094", "name": "hyperkinetic disorder", "description": "" }, { "id": "MONDO:0012151", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012151", "name": "attention deficit-hyperactivity disorder, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012151", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012151", "name": "ADHD3", "description": "" }, { "id": "MONDO:0012151", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012151", "name": "attention Deficit-hyperactivity disorder, susceptibility to, type 3", "description": "" }, { "id": "MONDO:0012151", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012151", "name": "attention deficit-hyperactivity disorder, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012150", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012150", "name": "attention deficit-hyperactivity disorder, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012150", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012150", "name": "ADHD2", "description": "" }, { "id": "MONDO:0012150", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012150", "name": "attention Deficit-hyperactivity disorder, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012150", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012150", "name": "attention deficit-hyperactivity disorder, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012149", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012149", "name": "attention deficit-hyperactivity disorder, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012149", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012149", "name": "ADHD1", "description": "" }, { "id": "MONDO:0012149", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012149", "name": "attention deficit-hyperactivity disorder, susceptibility to, 1", "description": "" }, { "id": "MONDO:0012149", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012149", "name": "attention deficit-hyperactivity disorder, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0012152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012152", "name": "attention deficit-hyperactivity disorder, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012152", "name": "ADHD4", "description": "" }, { "id": "MONDO:0012152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012152", "name": "attention Deficit-hyperactivity disorder, susceptibility to, type 4", "description": "" }, { "id": "MONDO:0012152", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012152", "name": "attention deficit-hyperactivity disorder, susceptibility to, 4", "description": "" }, { "id": "MONDO:0100518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100518", "name": "hereditary attention deficit-hyperactivity disorder", "description": "An instance of attention deficit-hyperactivity disorder that is caused by an inherited genomic modification in an individual." }, { "id": "MONDO:0012863", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012863", "name": "attention deficit-hyperactivity disorder, susceptibility to, 6", "description": "" }, { "id": "MONDO:0012863", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012863", "name": "ADHD6", "description": "" }, { "id": "MONDO:0012863", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012863", "name": "attention Deficit-hyperactivity disorder, susceptibility to, type 6", "description": "" }, { "id": "MONDO:0012863", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012863", "name": "attention deficit-hyperactivity disorder, susceptibility to, 6", "description": "" }, { "id": "MONDO:0012863", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012863", "name": "digit span quantitative trait locus", "description": "" }, { "id": "MONDO:0012862", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012862", "name": "attention deficit-hyperactivity disorder, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012862", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012862", "name": "ADHD5", "description": "" }, { "id": "MONDO:0012862", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012862", "name": "attention Deficit-hyperactivity disorder, susceptibility to, type 5", "description": "" }, { "id": "MONDO:0012862", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012862", "name": "attention deficit-hyperactivity disorder, susceptibility to, 5", "description": "" }, { "id": "MONDO:0012862", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012862", "name": "motor timing quantitative trait locus", "description": "" } ], "evidence": [ { "id": "1094", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1094" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "common_name": "Rat" } ], "gene": [ { "name": "Caly", "url": "https://www.uniprot.org/uniprot/P58821", "locus": { "chromosome": "1", "start_pos": 194862672, "end_pos": 194873551, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000018337", "url": "https://www.ensembl.org/id/ENSRNOG00000018337" } ] } } ], "crossref": [ { "id": "ENSRNOG00000018337", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000018337", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "192349", "url": "https://www.ncbi.nlm.nih.gov/gene/192349", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009431", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009431", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:192349", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:192349", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ILKQKHC", "url": "https://omabrowser.org/oma/group/ILKQKHC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4831126at2759", "url": "http://www.orthodb.org/?query=4831126at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28546", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28546", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28546:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28546:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06387", "url": "http://pfam.xfam.org/family/PF06387", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P58821", "url": "http://purl.obolibrary.org/obo/PR_P58821", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621719", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621719", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P58821-1", "url": "https://www.uniprot.org/uniprot/P58821-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVKLGCSFSGKPGKETGDQDGAAMDSVPLISPLDVSQLQPSFPDQVVIKTQTEYQLTSADQPKKFADLEGQRLACSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTAAAAAAAEGNEPSGKPLDMREKEDPQKAEDVPSQSPK", "length": 226, "header": "sp|P58821-1|CALY_RAT Isoform 1 of Neuron-specific vesicular protein calcyon OS=Rattus norvegicus OX=10116 GN=Caly PE=1 SV=1 CANONICAL=P58821-1" }, "isoforms": [ { "isoform_ac": "P58821-1", "url": "", "sequence": { "sequence": "MVKLGCSFSGKPGKETGDQDGAAMDSVPLISPLDVSQLQPSFPDQVVIKTQTEYQLTSADQPKKFADLEGQRLACSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTAAAAAAAEGNEPSGKPLDMREKEDPQKAEDVPSQSPK", "length": 226, "header": "sp|P58821-1|CALY_RAT Isoform 1 of Neuron-specific vesicular protein calcyon OS=Rattus norvegicus OX=10116 GN=Caly PE=1 SV=1 CANONICAL=P58821-1" }, "locus": { "chromosome": "1", "start_pos": 194867122, "end_pos": 194863133, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000089729", "url": "https://www.ensembl.org/id/ENSRNOT00000089729" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069564", "url": "https://www.ensembl.org/id/ENSRNOP00000069564" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Calcyon in the rat brain: cloning of cDNA and expression of mRNA.", "journal": "J. Comp. Neurol.", "date": "2002", "authors": "Zelenin S, Aperia A, Diaz Heijtz R", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "reference": [ { "type": "PubMed", "id": "11920718", "url": "https://glygen.org/publication/PubMed/11920718" } ] }, { "title": "Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Xiao J, Dai R, Negyessy L, Bergson C", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "reference": [ { "type": "PubMed", "id": "16595675", "url": "https://glygen.org/publication/PubMed/16595675" } ] }, { "title": "Calcyon mRNA expression in the frontal-striatal circuitry and its relationship to vesicular processes and ADHD.", "journal": "Behav. Brain Funct.", "date": "2007", "authors": "Alexeyenko A., Castellanos F.X., Heijtz R.D.", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "reference": [ { "type": "PubMed", "id": "17623072", "url": "https://glygen.org/publication/PubMed/17623072" } ] }, { "title": "Intracellular dynamics of calcyon, a neuron-specific vesicular protein.", "journal": "NeuroReport", "date": "2007", "authors": "Scott L., Brismar H., Zelenin S., Kruusmagi M.", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "reference": [ { "type": "PubMed", "id": "17885599", "url": "https://glygen.org/publication/PubMed/17885599" } ] }, { "title": "Calcyon forms a novel ternary complex with dopamine D1 receptor through PSD-95 protein and plays a role in dopamine receptor internalization.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Ha CM, Park D, Han JK, Jang JI, Park JY, Hwang EM, Seok H, Chang S", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" } ], "reference": [ { "type": "PubMed", "id": "22843680", "url": "https://glygen.org/publication/PubMed/22843680" } ] }, { "title": "Dynein binds and stimulates axonal motility of the endosome adaptor and NEEP21 family member, calcyon.", "journal": "The international journal of biochemistry & cell biology", "date": "2017", "authors": "Shi L, Muthusamy N, Smith D, Bergson C", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" } ], "reference": [ { "type": "PubMed", "id": "28734834", "url": "https://glygen.org/publication/PubMed/28734834" } ] }, { "title": "Coupling of microtubule motors with AP-3 generated organelles in axons by NEEP21 family member calcyon.", "journal": "Molecular biology of the cell", "date": "2018", "authors": "Shi L, Hines T, Bergson C, Smith D", "evidence": [ { "database": "RefSeq", "id": "NP_001177328", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001177328" } ], "reference": [ { "type": "PubMed", "id": "29949458", "url": "https://glygen.org/publication/PubMed/29949458" } ] } ], "pathway": [ { "id": "rno:192349", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:192349", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9DCA7-1", "protein_name": "Neuron-specific vesicular protein calcyon", "gene_name": "Caly", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVKLGCSFSGKPGKEAGDQDGAAMDSVPLISPLDVSQLQPSFSDQVVINTQTEYQLTSADQPKKFADLEGQRLACSHSEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTEMPAVWGNNYRTAKEEHKGTTPAAMAVSTAAAAAAAEGTEPSGKSLDTREKEDPQKAEGVPSQPPK", "length": 226 }, "evidence": [ { "id": "45230263", "url": "http://www.informatics.jax.org/homology/45230263", "database": "MGI" }, { "id": "P58821", "url": "https://omabrowser.org/oma/group/P58821/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NYX4-1", "protein_name": "Neuron-specific vesicular protein calcyon", "gene_name": "CALY", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ", "length": 217 }, "evidence": [ { "id": "45230263", "url": "http://www.informatics.jax.org/homology/45230263", "database": "MGI" }, { "id": "P58821", "url": "https://omabrowser.org/oma/group/P58821/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "positive regulation of clathrin coat assembly", "id": "GO:1905445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905445", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "postsynaptic neurotransmitter receptor internalization", "id": "GO:0098884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098884", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "dopamine receptor signaling pathway", "id": "GO:0007212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007212", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "endosomal transport", "id": "GO:0016197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016197", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "anterograde axonal transport", "id": "GO:0008089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008089", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "clathrin coat assembly", "id": "GO:0048268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048268", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "positive regulation of endocytosis", "id": "GO:0045807", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045807", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "positive regulation of retrograde axon cargo transport", "id": "GO:2001019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001019", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "cytoplasmic vesicle membrane", "id": "GO:0030659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030659", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "axon cytoplasm", "id": "GO:1904115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "postsynaptic endocytic zone", "id": "GO:0098843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098843", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" }, { "name": "clathrin light chain binding", "id": "GO:0032051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032051", "evidence": [ { "database": "UniProtKB", "id": "P58821", "url": "https://www.uniprot.org/uniprot/P58821" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }