{ "uniprot_canonical_ac": "P56405-1", "uniprot_ac": "P56405", "uniprot_id": "AQP8_RAT", "mass": { "chemical_mass": 28055.0, "monoisotopic_mass": 28055.0 }, "refseq": { "ac": "NP_062031", "name": "aquaporin-8", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" }, "gene_names": [ { "name": "Aqp8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P56405", "id": "P56405" }, { "name": "AQP-8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006230249", "id": "XP_006230249" }, { "name": "Aqp8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006230249", "id": "XP_006230249" } ], "protein_names": [ { "name": "Aquaporin-8", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P56405" }, { "name": "AQP-8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P56405" }, { "name": "aquaporin-8 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006230249", "id": "XP_006230249" }, { "name": "aquaporin-8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031", "id": "NP_062031" } ], "function": [ { "annotation": "AQP8 is a crucial H2O2 transporter in insulin-producing RINm5F cells.", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" }, { "database": "PubMed", "id": "33892285", "url": "https://glygen.org/publication/PubMed/33892285" } ] }, { "annotation": "Aquaporin 8 is involved in H2 O2 -mediated differential regulation of metabolic signaling by alpha1 - and beta-adrenoceptors in hepatocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" }, { "database": "PubMed", "id": "32115689", "url": "https://glygen.org/publication/PubMed/32115689" } ] }, { "annotation": "Channel that allows the facilitated permeation of water and uncharged molecules, such as hydrogen peroxide and the neutral form of ammonia (NH3), through cellular membranes such as plasma membrane, inner mitochondrial membrane and endoplasmic reticulum membrane of several tissues (PubMed:15988592, PubMed:9299432, PubMed:9374520, PubMed:31372390, PubMed:33892285, PubMed:12774023, PubMed:15948717, PubMed:16177191, PubMed:16624991, PubMed:17189259, PubMed:18059526, PubMed:20132793, PubMed:23299935, PubMed:15749715). The transport of ammonia neutral form induces a parallel transport of proton, at alkaline pH when the concentration of ammonia is high (PubMed:15988592). However, it is unclear whether the transport of proton takes place via the aquaporin or via an endogenous pathway (PubMed:15988592). Also, may transport ammonia analogs such as formamide and methylamine, a transport favourited at basic pH due to the increase of unprotonated (neutral) form, which is expected to favor diffusion (PubMed:15988592, PubMed:15749715, PubMed:15948717). Does not transport urea or glycerol (PubMed:15948717). The water transport mechanism is mercury- and copper-sensitive and passive in response to osmotic driving forces (PubMed:9374520, PubMed:9299432, PubMed:18059526, PubMed:20132793). At the canicular plasma membrane, mediates the osmotic transport of water toward the bile canaliculus and facilitates the cAMP-induced bile canalicular water secretion, a process involved in bile formation (By similarity). In addition, mediates the hydrogen peroxide release from hepatocyte mitochondria that modulates the SREBF2-mediated cholesterol synthesis and facilitates the mitochondrial ammonia uptake which is metabolized into urea, mainly under glucagon stimulation (PubMed:23299935, PubMed:20132793, PubMed:31372390). In B cells, transports the CYBB-generated hydrogen peroxide from the external leaflet of the plasma membrane to the cytosol to promote B cell activation and differentiation for signal amplification (By similarity). In the small intestine and colon system, mediates water transport through mitochondria and apical membrane of epithelial cells (PubMed:15749715, PubMed:18059526, PubMed:16177191). May play an important role in the adaptive response of proximal tubule cells to acidosis possibly facilitating mitochondrial ammonia transport (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405#function" }, { "database": "PubMed", "id": "12774023", "url": "https://glygen.org/publication/PubMed/12774023" }, { "database": "PubMed", "id": "18059526", "url": "https://glygen.org/publication/PubMed/18059526" }, { "database": "UniProtKB", "id": "P56404", "url": "https://www.uniprot.org/uniprot/P56404#function" }, { "database": "PubMed", "id": "16177191", "url": "https://glygen.org/publication/PubMed/16177191" }, { "database": "UniProtKB", "id": "O94778", "url": "https://www.uniprot.org/uniprot/O94778#function" }, { "database": "PubMed", "id": "31372390", "url": "https://glygen.org/publication/PubMed/31372390" }, { "database": "PubMed", "id": "15749715", "url": "https://glygen.org/publication/PubMed/15749715" }, { "database": "PubMed", "id": "16624991", "url": "https://glygen.org/publication/PubMed/16624991" }, { "database": "PubMed", "id": "15988592", "url": "https://glygen.org/publication/PubMed/15988592" }, { "database": "PubMed", "id": "9374520", "url": "https://glygen.org/publication/PubMed/9374520" }, { "database": "PubMed", "id": "17189259", "url": "https://glygen.org/publication/PubMed/17189259" }, { "database": "PubMed", "id": "23299935", "url": "https://glygen.org/publication/PubMed/23299935" }, { "database": "PubMed", "id": "20132793", "url": "https://glygen.org/publication/PubMed/20132793" }, { "database": "PubMed", "id": "33892285", "url": "https://glygen.org/publication/PubMed/33892285" }, { "database": "PubMed", "id": "15948717", "url": "https://glygen.org/publication/PubMed/15948717" }, { "database": "PubMed", "id": "9299432", "url": "https://glygen.org/publication/PubMed/9299432" } ] }, { "annotation": "Liquid water metabolic abnormalities and intestine permeability might be the mechanism of IBS by regulating AQP1, AQP3 and AQP8 via NF-kappaB pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" }, { "database": "PubMed", "id": "28525373", "url": "https://glygen.org/publication/PubMed/28525373" } ] }, { "annotation": "Mitochondrial AQP8 is involved in SREBP2-controlled hepatocyte cholesterol biosynthesis.", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" }, { "database": "PubMed", "id": "30579780", "url": "https://glygen.org/publication/PubMed/30579780" } ] } ], "disease": [ { "disease_id": "DOID:2316", "recommended_name": { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "brain ischemia", "description": "An ischemia that is characterized by insufficient blood flow to the brain to meet metabolic demand." }, "synonyms": [ { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischaemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "Ischemic encephalopathy", "description": "" }, { "id": "DOID:2316", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2316", "name": "cerebral ischemia", "description": "" } ], "evidence": [ { "id": "2316", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2316" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "common_name": "Rat" } ], "gene": [ { "name": "Aqp8", "url": "https://www.uniprot.org/uniprot/P56405", "locus": { "chromosome": "1", "start_pos": 177999158, "end_pos": 177993305, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000014652", "url": "https://www.ensembl.org/id/ENSRNOG00000014652" } ] } } ], "crossref": [ { "id": "ENSRNOG00000014652", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000014652", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "29172", "url": "https://www.ncbi.nlm.nih.gov/gene/29172", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000425", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000425", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023277", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023277", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034294", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034294", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:29172", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29172", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GTMQANV", "url": "https://omabrowser.org/oma/group/GTMQANV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3236018at2759", "url": "http://www.orthodb.org/?query=3236018at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45665", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45665", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45665:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45665:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00230", "url": "http://pfam.xfam.org/family/PF00230", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P56405", "url": "http://purl.obolibrary.org/obo/PR_P56405", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-432047", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-432047", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2146", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2146", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "28747", "url": "https://www.rhea-db.org/rhea/28747", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "29667", "url": "https://www.rhea-db.org/rhea/29667", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74375", "url": "https://www.rhea-db.org/rhea/74375", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74387", "url": "https://www.rhea-db.org/rhea/74387", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74391", "url": "https://www.rhea-db.org/rhea/74391", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0H2UHM1", "url": "https://www.uniprot.org/uniprot/A0A0H2UHM1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0H2UHM1-1", "url": "https://www.uniprot.org/uniprot/A0A0H2UHM1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GK50", "url": "https://www.uniprot.org/uniprot/A0A8I6GK50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GK50-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GK50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P56405-1", "url": "https://www.uniprot.org/uniprot/P56405-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR", "length": 263, "header": "sp|P56405-1|AQP8_RAT Isoform 1 of Aquaporin-8 OS=Rattus norvegicus OX=10116 GN=Aqp8 PE=1 SV=1 CANONICAL=P56405-1" }, "isoforms": [ { "isoform_ac": "A0A0H2UHM1-1", "url": "", "sequence": { "sequence": "MSGETPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR", "length": 262, "header": "tr|A0A0H2UHM1-1|AQP8_RAT Computationally mapped isoform of Aquaporin-8 OS=Rattus norvegicus OX=10116 GN=Aqp8 PE=1 SV=1 CANONICAL=P56405-1" }, "locus": { "chromosome": "1", "start_pos": 177998604, "end_pos": 177993481, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000019939.7", "url": "https://www.ensembl.org/id/ENSRNOT00000019939.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000019939.6", "url": "https://www.ensembl.org/id/ENSRNOP00000019939.6" } ] } }, { "isoform_ac": "A0A8I6GK50-1", "url": "", "sequence": { "sequence": "MGASTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR", "length": 262, "header": "tr|A0A8I6GK50-1|AQP8_RAT Computationally mapped isoform of Aquaporin-8 OS=Rattus norvegicus OX=10116 GN=Aqp8 PE=1 SV=1 CANONICAL=P56405-1" }, "locus": { "chromosome": "1", "start_pos": 177998604, "end_pos": 177993543, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000118056.1", "url": "https://www.ensembl.org/id/ENSRNOT00000118056.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000092342.1", "url": "https://www.ensembl.org/id/ENSRNOP00000092342.1" } ] } }, { "isoform_ac": "P56405-1", "url": "", "sequence": { "sequence": "MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR", "length": 263, "header": "sp|P56405-1|AQP8_RAT Isoform 1 of Aquaporin-8 OS=Rattus norvegicus OX=10116 GN=Aqp8 PE=1 SV=1 CANONICAL=P56405-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 141, "start_aa": "Asn", "end_pos": 141, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn141", "evidence": [ { "id": "P56405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56405#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Evidence that aquaporin-8 is located in the basolateral membrane of rat submandibular gland acinar cells.", "journal": "Pflugers Arch.", "date": "2000", "authors": "Baum B.J., Goldsmith C.M., Hoque A.T., Wellner R.B.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "11205061", "url": "https://glygen.org/publication/PubMed/11205061" } ] }, { "title": "The water channel aquaporin-8 is mainly intracellular in rat hepatocytes, and its plasma membrane insertion is stimulated by cyclic AMP.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Garc\u00eda F, Kierbel A, Larocca M C, Gradilone S A, Splinter P, LaRusso N F, Marinelli R A", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "11278499", "url": "https://glygen.org/publication/PubMed/11278499" } ] }, { "title": "Expression and localization of the aquaporin-8 water channel in rat testis.", "journal": "Biol. Reprod.", "date": "2001", "authors": "Calamita G, Mazzone A, Cho Y S, Valenti G, Svelto M", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "11369592", "url": "https://glygen.org/publication/PubMed/11369592" } ] }, { "title": "Immunolocalization of aquaporin-8 in rat digestive organs and testis.", "journal": "Arch. Histol. Cytol.", "date": "2001", "authors": "Tani T, Koyama Y, Nihei K, Hatakeyama S, Ohshiro K, Yoshida Y, Yaoita E, Sakai Y, Hatakeyama K, Yamamoto T", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "11436986", "url": "https://glygen.org/publication/PubMed/11436986" } ] }, { "title": "Glucagon induces the plasma membrane insertion of functional aquaporin-8 water channels in isolated rat hepatocytes.", "journal": "Hepatology", "date": "2003", "authors": "Garcia F., Larocca M.C., Tietz P.S., Larusso N.F., Marinelli R.A., Carreras F.I., Gradilone S.A., Huebert R.C., Kierbel A.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "12774023", "url": "https://glygen.org/publication/PubMed/12774023" } ] }, { "title": "The inner mitochondrial membrane has aquaporin-8 water channels and is highly permeable to water.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Thomas D., Svelto M., Calamita G., Ferri D., Liquori G.E., Cavalier A., Gena P.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "15749715", "url": "https://glygen.org/publication/PubMed/15749715" } ] }, { "title": "Purification and functional characterization of aquaporin-8.", "journal": "Biol. Cell", "date": "2006", "authors": "Liu K, Nagase H, Huang CG, Calamita G, Agre P", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "15948717", "url": "https://glygen.org/publication/PubMed/15948717" } ] }, { "title": "NH3 and NH4+ permeability in aquaporin-expressing Xenopus oocytes.", "journal": "Pflugers Arch.", "date": "2005", "authors": "Klaerke D.A., Zeuthen T., Ferri D., Holm L.M., Jahn T.P., Moeller A.L., Schjoerring J.K.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "15988592", "url": "https://glygen.org/publication/PubMed/15988592" } ] }, { "title": "Aquaporin-8 is involved in water transport in isolated superficial colonocytes from rat proximal colon.", "journal": "J. Nutr.", "date": "2005", "authors": "D'Adamo P., LaRusso N.F., Splinter P.L., Laforenza U., Gastaldi G., Tosco M., Cova E., Grazioli M., Tritto S., Ventura U.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "16177191", "url": "https://glygen.org/publication/PubMed/16177191" } ] }, { "title": "Further evidence for AQP8 expression in the myoepithelium of rat submandibular and parotid glands.", "journal": "Pflugers Arch.", "date": "2006", "authors": "Swaim W.D., Baum B.J., Redman R.S., Wellner R.B.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "16311720", "url": "https://glygen.org/publication/PubMed/16311720" } ] }, { "title": "Evidence from knockout mice against physiologically significant aquaporin 8-facilitated ammonia transport.", "journal": "Am. J. Physiol.", "date": "2006", "authors": "Yang B., Zhao D., Verkman A.S., Solenov E.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "16624991", "url": "https://glygen.org/publication/PubMed/16624991" } ] }, { "title": "Fast and selective ammonia transport by aquaporin-8.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Liu K., Agre P., Pohl P., Saparov S.M.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "17189259", "url": "https://glygen.org/publication/PubMed/17189259" } ] }, { "title": "Osmotic water permeability of rat intestinal brush border membrane vesicles: involvement of aquaporin-7 and aquaporin-8 and effect of metal ions.", "journal": "Biochem. Cell Biol.", "date": "2007", "authors": "Zelenin S., Laforenza U., Gastaldi G., Zelenina M., Orsenigo M.N., Grazioli M., Tritto S., Ventura U.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "18059526", "url": "https://glygen.org/publication/PubMed/18059526" } ] }, { "title": "Aquaporin-8-facilitated mitochondrial ammonia transport.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2010", "authors": "Svelto M., Calamita G., Marinelli R.A., Soria L.R., Altamura N., Fanelli E.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "20132793", "url": "https://glygen.org/publication/PubMed/20132793" } ] }, { "title": "Mitochondrial aquaporin-8 in renal proximal tubule cells: evidence for a role in the response to metabolic acidosis.", "journal": "Am. J. Physiol.", "date": "2012", "authors": "Trumper L., Molinas S.M., Marinelli R.A.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "22622463", "url": "https://glygen.org/publication/PubMed/22622463" } ] }, { "title": "Ammonia detoxification via ureagenesis in rat hepatocytes involves mitochondrial aquaporin-8 channels.", "journal": "Hepatology", "date": "2013", "authors": "Soria LR, Marrone J, Calamita G, Marinelli RA", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "23299935", "url": "https://glygen.org/publication/PubMed/23299935" } ] }, { "title": "Aquaporins 1, 3 and 8 expression in irritable bowel syndrome rats' colon via NF-kappaB pathway.", "journal": "Oncotarget", "date": "2017", "authors": "Chao G, Zhang S", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" } ], "reference": [ { "type": "PubMed", "id": "28525373", "url": "https://glygen.org/publication/PubMed/28525373" } ] }, { "title": "Mitochondrial aquaporin-8 is involved in SREBP-controlled hepatocyte cholesterol biosynthesis.", "journal": "Free radical biology & medicine", "date": "2019", "authors": "Danielli M, Marrone J, Capiglioni AM, Marinelli RA", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" } ], "reference": [ { "type": "PubMed", "id": "30579780", "url": "https://glygen.org/publication/PubMed/30579780" } ] }, { "title": "Data of H2O2 release from AQP8-knockdown rat hepatocyte mitochondria.", "journal": "Data Brief", "date": "2019", "authors": "Capiglioni A.M., Danielli M., Marinelli R.A., Marrone J.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "31372390", "url": "https://glygen.org/publication/PubMed/31372390" } ] }, { "title": "Aquaporin 8 is involved in H2 O2 -mediated differential regulation of metabolic signaling by alpha1 - and beta-adrenoceptors in hepatocytes.", "journal": "FEBS letters", "date": "2020", "authors": "Vilchis-Landeros M, Guinzberg R, Riveros-Rosas H, Villalobos-Molina R, Pina E", "evidence": [ { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" } ], "reference": [ { "type": "PubMed", "id": "32115689", "url": "https://glygen.org/publication/PubMed/32115689" } ] }, { "title": "AQP8 is a crucial H2O2 transporter in insulin-producing RINm5F cells.", "journal": "Redox Biol.", "date": "2021", "authors": "Kruger C, Waldeck-Weiermair M, Kaynert J, Pokrant T, Komaragiri Y, Otto O, Michel T, Elsner M", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" }, { "database": "RefSeq", "id": "NP_062031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062031" } ], "reference": [ { "type": "PubMed", "id": "33892285", "url": "https://glygen.org/publication/PubMed/33892285" } ] }, { "title": "Cloning and functional expression of a second new aquaporin abundantly expressed in testis.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Ishibashi K., Kageyama Y., Kuwahara M., Marumo F., Sasaki S., Tohsaka A.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "9299432", "url": "https://glygen.org/publication/PubMed/9299432" } ] }, { "title": "Molecular cloning of a new aquaporin from rat pancreas and liver.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Kawasaki K., Yamamoto T., Sato N., Hatakeyama K., Funaki H., Kihara I., Koyama Y., Yaoita E., Kondo D.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "reference": [ { "type": "PubMed", "id": "9374520", "url": "https://glygen.org/publication/PubMed/9374520" } ] } ], "pathway": [ { "id": "rno:29172", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29172", "resource": "KEGG Pathway" }, { "id": "R-RNO-432047", "name": "Passive transport by Aquaporins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-432047", "resource": "Reactome", "description": "Passive transport by Aquaporins" } ], "orthologs": [ { "uniprot_canonical_ac": "O94778-1", "protein_name": "Aquaporin-8", "gene_name": "AQP8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR", "length": 261 }, "evidence": [ { "id": "45227277", "url": "http://www.informatics.jax.org/homology/45227277", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P56404-1", "protein_name": "Aquaporin-8", "gene_name": "Aqp8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSGEQTPMCSMDLPEVKVKTSMAGRCRVFWYEQYVQPCIVELVGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGSISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLLIGDEKTRLILKSR", "length": 261 }, "evidence": [ { "id": "45227277", "url": "http://www.informatics.jax.org/homology/45227277", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "intracellular vesicle", "id": "GO:0097708", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097708", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum", "id": "GO:0005790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005790", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "intracellular canaliculus", "id": "GO:0046691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046691", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "apical part of cell", "id": "GO:0045177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045177", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum membrane", "id": "GO:0030868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030868", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "brush border membrane", "id": "GO:0031526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031526", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "cellular response to cAMP", "id": "GO:0071320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071320", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "regulation of cholesterol biosynthetic process", "id": "GO:0045540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045540", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "cellular detoxification", "id": "GO:1990748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990748", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "hydrogen peroxide transmembrane transport", "id": "GO:0080170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0080170", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "ammonium import across plasma membrane", "id": "GO:0140157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140157", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "canalicular bile acid transport", "id": "GO:0015722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015722", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "water transport", "id": "GO:0006833", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006833", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "urea transport", "id": "GO:0015840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015840", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "transepithelial water transport", "id": "GO:0035377", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035377", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "ammonium transmembrane transport", "id": "GO:0072488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072488", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "methylammonium transmembrane transport", "id": "GO:0072489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072489", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "methylammonium transport", "id": "GO:0015843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015843", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "water channel activity", "id": "GO:0015250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015250", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "urea channel activity", "id": "GO:0015265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015265", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "ammonium transmembrane transporter activity", "id": "GO:0008519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008519", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "methylammonium channel activity", "id": "GO:0015264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015264", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" }, { "name": "channel activity", "id": "GO:0015267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015267", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" }, { "database": "PubMed", "id": "11278499", "url": "https://glygen.org/publication/PubMed/11278499" }, { "database": "PubMed", "id": "11436986", "url": "https://glygen.org/publication/PubMed/11436986" }, { "database": "PubMed", "id": "11369592", "url": "https://glygen.org/publication/PubMed/11369592" } ] }, { "annotation": "Persulfidation at Cys-55 is required to gate AQP8 channel; under stress condition, hydrogen peroxide accumulates in the cell leading to CBS activation that produces hydrogen sulfide inducing persulfidation of oxidized Cys-55 (C55-SOH).", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" }, { "database": "PubMed", "id": "O94778", "url": "https://glygen.org/publication/PubMed/O94778" } ] }, { "annotation": "Sulfenylation at Cys-55(C55-SOH) when hydrogen peroxide flows through the AQP8 channel, making it susceptible to hydrogen sulfide produced by CBS.", "evidence": [ { "database": "UniProtKB", "id": "P56405", "url": "https://www.uniprot.org/uniprot/P56405" }, { "database": "PubMed", "id": "O94778", "url": "https://glygen.org/publication/PubMed/O94778" } ] } ], "interactions": [], "reactions": [ { "id": "28747", "name": "", "equation": "NH4(+)(in) = NH4(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "28747", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/28747" } ] }, { "id": "29667", "name": "", "equation": "H2O(in) = H2O(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "29667", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/29667" } ] }, { "id": "74375", "name": "", "equation": "H2O2(out) = H2O2(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74375", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74375" } ] }, { "id": "74387", "name": "", "equation": "formamide(out) = formamide(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74387", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74387" } ] }, { "id": "74391", "name": "", "equation": "methylamine(out) = methylamine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74391", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74391" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }